DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and RPT1

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_012777.1 Gene:RPT1 / 853712 SGDID:S000001628 Length:467 Species:Saccharomyces cerevisiae


Alignment Length:260 Identity:46/260 - (17%)
Similarity:80/260 - (30%) Gaps:75/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 EQDPLEMMASINKCAEEAIK-----QLPEQGFSASDIVTVGITNQRETTIVWDAVTGKPLYNALL 133
            |:.|....:.:..|.::..|     :||.  .|.....|:||...:...:.....|||.|....:
Yeast   201 EEKPDVTYSDVGGCKDQIEKLREVVELPL--LSPERFATLGIDPPKGILLYGPPGTGKTLCARAV 263

  Fly   134 WKDIRTSTTVEQIVAKVQDPNHFRSSTGLPISTYFSALKIRWLRDNVPEVRQAIRERRCKAGTVD 198
            ..  ||..|..:::.                    |.|..:::.:....||:.....|.|...:.
Yeast   264 AN--RTDATFIRVIG--------------------SELVQKYVGEGARMVRELFEMARTKKACII 306

  Fly   199 SWIVWNLTNGA-------------------------------LHITDVTNASRTLLMNLETQAWD 232
            .:...:...||                               :.:...||...||         |
Yeast   307 FFDEIDAVGGARFDDGAGGDNEVQRTMLELITQLDGFDPRGNIKVMFATNRPNTL---------D 362

  Fly   233 PVLLKTFGIREEM---LPTIHSCSEIF---GKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPG 291
            |.||:...|..::   ||.:...:.||   .|..|....:|...:|.:..|...:.|..:|.:.|
Yeast   363 PALLRPGRIDRKVEFSLPDLEGRANIFRIHSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAG 427

  Fly   292  291
            Yeast   428  427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 46/260 (18%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 46/260 (18%)
RPT1NP_012777.1 RPT1 28..464 CDD:224143 46/260 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.