DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and YTA7

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_011786.1 Gene:YTA7 / 853186 SGDID:S000003502 Length:1379 Species:Saccharomyces cerevisiae


Alignment Length:175 Identity:39/175 - (22%)
Similarity:61/175 - (34%) Gaps:46/175 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YTTPDFKEIAAHRVELSVITPQDGWYEQDPLEMMASINKCAEEAIKQLPEQGFSASDIVTVGITN 112
            |||    |:........:.|..|....::|.|...|:.       .|:.|:.||..|..|..|.:
Yeast  1225 YTT----ELIQATCTSEITTDDDERARKEPKENEDSLQ-------TQVTEENFSKIDANTNNINH 1278

  Fly   113 QRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQ-----IVAKVQDPNHFRSSTGLPIST------ 166
            .:|...|     .||  |:|       ..|||:     |..:|.:|...:.|....|.|      
Yeast  1279 VKEIQSV-----NKP--NSL-------HETVEKRERSPIPKEVVEPEQGKKSDKELILTPEQIKK 1329

  Fly   167 ----------YFSALKIRWLRDNVPEVRQAIRERRCKAGTVDSWI 201
                      .|:..::..:..:|.::....:....|.||||..|
Yeast  1330 VSACLIEHCQNFTVSQLEDVHSSVAKIIWKSKSAWDKTGTVDEII 1374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 39/175 (22%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 39/175 (22%)
YTA7NP_011786.1 RecA-like_Yta7-like 414..583 CDD:410925
SpoVK 430..>882 CDD:223540
Bromo_TBP7_like 979..1098 CDD:99923
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.