DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and RPT2

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_010277.1 Gene:RPT2 / 851557 SGDID:S000002165 Length:437 Species:Saccharomyces cerevisiae


Alignment Length:370 Identity:72/370 - (19%)
Similarity:127/370 - (34%) Gaps:134/370 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SSADV--PFRSK-ELRKQSLIQHTG-------LVGVIDEGTKTIGFSIYTTPDF---------KE 55
            |::::  ||..| |..|:.|.:..|       |..:||:....:  :..|.||:         ||
Yeast    77 SNSEILKPFEKKQEEEKKQLEEIRGNPLSIGTLEEIIDDDHAIV--TSPTMPDYYVSILSFVDKE 139

  Fly    56 -------IAAHRVELSVI-TPQDGWYEQDPLEMMASINKCAEEA---IKQLPEQGFSASDIVTVG 109
                   :..|...:|:: ..||   :.||:..:..::|...|:   |..|..|.....:.|.:.
Yeast   140 LLEPGCSVLLHHKTMSIVGVLQD---DADPMVSVMKMDKSPTESYSDIGGLESQIQEIKESVELP 201

  Fly   110 ITNQRETTIVWDAVTGKP-----LYNA------LLWKDI--RTSTTVEQIVAKVQDPNHFRSSTG 161
            :|:..    :::.:..||     ||.|      ||.|.:  :||.|..:||.             
Yeast   202 LTHPE----LYEEMGIKPPKGVILYGAPGTGKTLLAKAVANQTSATFLRIVG------------- 249

  Fly   162 LPISTYFSALKIRWLRD--------------NVP------------------------EVRQAIR 188
                   |.|..::|.|              |.|                        |:::.:.
Yeast   250 -------SELIQKYLGDGPRLCRQIFKVAGENAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTML 307

  Fly   189 ERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLETQAWDPVLLKTFGIREEML---PTIH 250
            |...:....|.       .|.:.:...||...||         ||.|::...|..::|   |.:.
Yeast   308 ELLNQLDGFDD-------RGDVKVIMATNKIETL---------DPALIRPGRIDRKILFENPDLS 356

  Fly   251 SCSEIFGKITSERSPLRGMTLSGIMGNQQASLLG----QMCVKPG 291
            :..:|.|..||:.:....:.|..::..:. .|.|    .||.:.|
Yeast   357 TKKKILGIHTSKMNLSEDVNLETLVTTKD-DLSGADIQAMCTEAG 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 65/346 (19%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 65/346 (19%)
RPT2NP_010277.1 PTZ00361 1..437 CDD:185575 72/370 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.