DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and RPT1A

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_175778.1 Gene:RPT1A / 841812 AraportID:AT1G53750 Length:426 Species:Arabidopsis thaliana


Alignment Length:102 Identity:26/102 - (25%)
Similarity:37/102 - (36%) Gaps:33/102 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 GALHITDVTNASRTLLMNLETQAWDPVLLK--------TFGIREEMLPTIHSCSEIFGKITSERS 264
            |.:.:...||...||         ||.||:        .||     ||.:.|.::||...|...:
plant   306 GNIKVLMATNRPDTL---------DPALLRPGRLDRKVEFG-----LPDLESRTQIFKIHTRTMN 356

  Fly   265 PLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSGC 301
            ..|.:         :..||.::|  |..|....||.|
plant   357 CERDI---------RFELLARLC--PNSTGADIRSVC 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 26/102 (25%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 26/102 (25%)
RPT1ANP_175778.1 RPT1 26..423 CDD:224143 26/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.