DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and AT1G05910

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_563753.1 Gene:AT1G05910 / 837101 AraportID:AT1G05910 Length:1210 Species:Arabidopsis thaliana


Alignment Length:372 Identity:66/372 - (17%)
Similarity:123/372 - (33%) Gaps:106/372 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DPLEMMASINKCAEEAIKQ--------LPEQGFSASDIVTVGITNQRETTIVWDAVTG---KP-- 127
            |.::.:|.:....:|.|..        |.:...|...:|.:|.||:      .||:.|   :|  
plant   486 DEIDGLAPVRSSKQEQIHNSIVSTLLALMDGLDSRGQVVLIGATNR------VDAIDGALRRPGR 544

  Fly   128 ---LYNALL----------------WKDIRTSTTVEQIVAKVQDPNHFRSSTGLPISTYFSALKI 173
               .:|..|                ||...|....|::.|...      ...|..:....:...|
plant   545 FDREFNFSLPGCEARAEILDIHTRKWKHPPTRELKEELAATCV------GYCGADLKALCTEAAI 603

  Fly   174 RWLRDNVPEVRQAIRERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMN---LETQAWDPVL 235
            |..|:..|:|..:..:.....|.|      |:...  |..:..:|.......   ::::...||:
plant   604 RAFREKYPQVYTSDDKYAIDVGLV------NVEKS--HFVEAMSAITPAAHRGSVVQSRPLSPVV 660

  Fly   236 LKTFGIREEMLPTIHSCSEIF--GKITSERSPLRGMTLSG---IMGNQQASLLGQMCVKPGQTKN 295
            |..  :...:|.::...|:||  ...:||.:.|..:|...   ::...:..|||      |:...
plant   661 LPC--LHRHLLESMSLISDIFPSSATSSELTKLSILTFGSAIPLVYRPRLLLLG------GEGVG 717

  Fly   296 TYRSGCFLLCNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSWLQNKVRILPDS 360
            ....|..:|           |.|.....:.||  .|::.:..||.:                |:.
plant   718 LDHLGPAIL-----------HELEKFPIHSLG--LPSLLSDPGAKT----------------PEE 753

  Fly   361 RDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQNA----RGIIIGLTQ 403
            .....::|...|:..:.::|.|..     |.:||    |.:.:.|.:
plant   754 ALVHIFSEARRTTPSILYIPMFNN-----WWENAHEQLRAVFLTLLE 795

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 66/372 (18%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 66/372 (18%)
AT1G05910NP_563753.1 CDC48 <377..>652 CDD:273521 32/185 (17%)
Bromo_AAA 895..1005 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.