DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and KATNAL2

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001340828.1 Gene:KATNAL2 / 83473 HGNCID:25387 Length:564 Species:Homo sapiens


Alignment Length:309 Identity:56/309 - (18%)
Similarity:94/309 - (30%) Gaps:101/309 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 SPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSGCFLLCNT---------------GDKPVF 313
            ||.:|:.|.|               .||..|..........|.|               ||....
Human   311 SPWKGLLLYG---------------PPGTGKTLLAKAVATECKTTFFNISASTIVSKWRGDSEKL 360

  Fly   314 SRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSW-----LQNKVRILPDSRDAEKYAEMVPTS 373
            .|  :|..:|....|....:..:|..:|..|.|...     |:.|..:|..       .:.:..|
Human   361 VR--VLFELARYHAPSTIFLDELESVMSQRGTASGGEHEGSLRMKTELLVQ-------MDGLARS 416

  Fly   374 GDVYFVPAFTGLYAPYW-------RQNARGIIIGLTQFTRKNHIVRAALESICFQTRDILECMHQ 431
            .|:.||.|.:.|  | |       |:..:.|::.|.....:..::...|..:. ::| .|| :|.
Human   417 EDLVFVLAASNL--P-WELDCAMLRRLEKRILVDLPSREARQAMIYHWLPPVS-KSR-ALE-LHT 475

  Fly   432 ECGYEINKLHADG------KLTTNNLLMQ-----------LQADTIGMPVFRSQLMDSTAFGAAM 479
            |..|.:.....:|      ||......|:           .|:::..:|..:..::.:..|...:
Human   476 ELEYSVLSQETEGYSGSDIKLVCREAAMRPVRKIFDALENHQSESSDLPRIQLDIVTTADFLDVL 540

  Fly   480 CAAQADGVNLCQFEPEKRYYENVHYDTFLATTTDVERKERYGKWKRAVE 528
            ...:....||.|                           ||..|:|..|
Human   541 THTKPSAKNLAQ---------------------------RYSDWQREFE 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 56/309 (18%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 56/309 (18%)
KATNAL2NP_001340828.1 LisH 51..81 CDD:128913
SpoVK <264..559 CDD:223540 54/304 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.