DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and AT5G20000

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_197500.1 Gene:AT5G20000 / 832122 AraportID:AT5G20000 Length:419 Species:Arabidopsis thaliana


Alignment Length:332 Identity:66/332 - (19%)
Similarity:122/332 - (36%) Gaps:75/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RSKELRKQ-SLIQHTGLVGVIDEGTKTIGFS---IYTTPDFKEIA--AHRVELSVITP------- 68
            |.:.||:: .|:|..|  ..:.|..|.:|.:   :...|:.|.:.  ...::::.:||       
plant    67 RVRMLREELQLLQEPG--SYVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKLTPSTRVALR 129

  Fly    69 QDGWY-------EQDPLEMMASINKCAE---EAIKQLPEQGFSASDIV-----------TVGITN 112
            .|.:.       :.|||..:..:.|..:   :.|..|.:|.....:::           ::||..
plant   130 NDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQ 194

  Fly   113 QRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQIVAKVQDPNHFRSSTGLPISTYF--SALKIRW 175
            .:...:.....|||              |.:.:.||...|....|.|....:..|.  .:..:|.
plant   195 PKGVLLYGPPGTGK--------------TLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRE 245

  Fly   176 L----RDNVPEV-----RQAIRERRCKAGT--VDSWI---VWNLTNGALHITDVTNASRTLLMNL 226
            |    |::.|.:     ..:|...|.::|:  .||.:   :..|.| .|...:.:|..:.|:...
plant   246 LFVMAREHAPSIIFMDEIDSIGSARMESGSGNGDSEVQRTMLELLN-QLDGFEASNKIKVLMATN 309

  Fly   227 ETQAWDPVLLKTFGIREEM---LPTIHSCSEIFGKITSERSPL-RGMTLSGI---MGNQQASLLG 284
            .....|..||:...|..::   .|...|..:|. ||.|.:..| ||:.|..|   |.....:.|.
plant   310 RIDILDQALLRPGRIDRKIEFPNPNEESRFDIL-KIHSRKMNLMRGIDLKKIAEKMNGASGAELK 373

  Fly   285 QMCVKPG 291
            .:|.:.|
plant   374 AVCTEAG 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 61/317 (19%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 61/317 (19%)
AT5G20000NP_197500.1 RPT1 34..417 CDD:224143 66/332 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.