DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and RPT2a

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_194633.1 Gene:RPT2a / 829025 AraportID:AT4G29040 Length:443 Species:Arabidopsis thaliana


Alignment Length:291 Identity:62/291 - (21%)
Similarity:100/291 - (34%) Gaps:94/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHRVELSVI-TPQDGWYEQDPLEMMASINKCAEEA- 91
            :.|::..:|:.....|.|         |..|...|||: ..||   |.||:..:..:.|...|: 
plant   135 YVGILSFVDKDQLEPGCS---------ILMHNKVLSVVGILQD---EVDPMVSVMKVEKAPLESY 187

  Fly    92 ------------IKQLPEQGFSASDIV-TVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTV 143
                        ||:..|...:..::. .:||...:...:..:..|||    .||.|.:..||  
plant   188 ADIGGLEAQIQEIKEAVELPLTHPELYEDIGIKPPKGVILYGEPGTGK----TLLAKAVANST-- 246

  Fly   144 EQIVAKVQDPNHFRSSTGLPISTYFSALKIRWLRDNVPEVRQAIR-------------------- 188
                          |:|.|.:  ..|.|..::|.|....||:..|                    
plant   247 --------------SATFLRV--VGSELIQKYLGDGPKLVRELFRVADDLSPSIVFIDEIDAVGT 295

  Fly   189 ---------ERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLETQAWDPVLLKTFGIREE 244
                     ||..:...::   :.|..:|.....||    :.:|.....::.||.||:...|..:
plant   296 KRYDAHSGGEREIQRTMLE---LLNQLDGFDSRGDV----KVILATNRIESLDPALLRPGRIDRK 353

  Fly   245 M---LPTIHSCSEIFGKITSERSPLRGMTLS 272
            :   ||.|.:...||...||:      ||||
plant   354 IEFPLPDIKTRRRIFQIHTSK------MTLS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 62/289 (21%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 62/289 (21%)
RPT2aNP_194633.1 PTZ00361 7..443 CDD:185575 62/291 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.