DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and Psmc5

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_112411.1 Gene:Psmc5 / 81827 RGDID:708376 Length:406 Species:Rattus norvegicus


Alignment Length:336 Identity:67/336 - (19%)
Similarity:119/336 - (35%) Gaps:76/336 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SADVPFRSKELRKQSLIQHTG-----LVGVIDEGTKTIGFSIYTTPDFKEIAAHRVELSVITP-- 68
            :|.|....:||:   |:|..|     :|..:|:  |.:...::....|.......::::.:||  
  Rat    53 NAKVRLLREELQ---LLQEQGSYVGEVVRAMDK--KKVLVKVHPEGKFVVDVDKNIDINDVTPNC 112

  Fly    69 -----QDGW-------YEQDPL--------------EMMASINKCAEEAIKQLPEQGFSASDIV- 106
                 .|.:       .:.|||              ||:..::|..:| ||::.|......::. 
  Rat   113 RVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKE-IKEVIELPVKHPELFE 176

  Fly   107 TVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQIVAKVQDPNHFRSSTGLPISTYF--S 169
            .:||...:...:.....|||              |.:.:.||...|....|.|....:..:.  .
  Rat   177 ALGIAQPKGVLLYGPPGTGK--------------TLLARAVAHHTDCTFIRVSGSELVQKFIGEG 227

  Fly   170 ALKIRWL----RDNVPEV-----RQAIRERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMN 225
            |..:|.|    |::.|.:     ..:|...|.:.|:.....|.......|:..|...|::.:.:.
  Rat   228 ARMVRELFVMAREHAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVI 292

  Fly   226 LET---QAWDPVLLKTFGI--REEMLPTIHSCSEIFGKITSERSPL-RGMTLSGIM----GNQQA 280
            :.|   ...|..||:...|  :.|..|..........||.|.:..| ||:.|..|.    |...|
  Rat   293 MATNRIDILDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGA 357

  Fly   281 SLLGQMCVKPG 291
            .:.| :|.:.|
  Rat   358 EVKG-VCTEAG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 61/316 (19%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 61/316 (19%)
Psmc5NP_112411.1 RPT1 4..404 CDD:224143 67/336 (20%)
May mediate interaction with PRPF9. /evidence=ECO:0000250|UniProtKB:P62196 186..406 41/197 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.