DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and Atad2

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_081711.2 Gene:Atad2 / 70472 MGIID:1917722 Length:1364 Species:Mus musculus


Alignment Length:580 Identity:113/580 - (19%)
Similarity:174/580 - (30%) Gaps:236/580 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KELRKQSLIQHTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHRVELSVITPQDGWYEQDPLEMMAS 83
            |::|:|.:.:...| ||.:| |:....::||....|  |..|.:......|||..|.        
Mouse   190 KKMRRQRMKKLEDL-GVFNE-TEESNLTMYTRGKLK--AIQRADEETTDNQDGSVES-------- 242

  Fly    84 INKCAEEAIKQLPEQGFSASDIVTVG---------ITNQRETTIVWDA-VTGKPLYNALLWKDIR 138
                :||..:|..:.|....|.....         ...||:||:.:.: :..||.:.        
Mouse   243 ----SEEGEEQEDDDGEDEDDEDEEEGEEDNQKRYYLRQRKTTVYYQSPLESKPRHQ-------- 295

  Fly   139 TSTTVEQIVAKVQDPNHFRSSTGLPISTYFSALKIRWLRDNVPEVRQAIRERRCKAGTVDSWIVW 203
                        :.||.|.|....|....|   ::.......|..::..|.|.            
Mouse   296 ------------RKPNMFYSGPASPARPRF---RLSSTGPRSPYCKRMSRRRH------------ 333

  Fly   204 NLTNGALHITDVTNAS--------------------RTLLMNLETQA-----------------W 231
                 |:|.:|.|::|                    |.|.:|.....                 .
Mouse   334 -----AIHSSDSTSSSSSEDDCFERRTKRNRNRAINRCLPLNFRKDEIRGIYKDRMKIGASLADV 393

  Fly   232 DPVLLKTFGIR--------------EEML--PTIHSCSEIFGKITSERSPLRGMTLSGIMGNQQA 280
            ||:.|.| .:|              :||:  |.::  .|:|.|...:  |.||....|       
Mouse   394 DPMQLDT-SVRFDSVGGLSSHIAALKEMVVFPLLY--PEVFEKFKIQ--PPRGCLFYG------- 446

  Fly   281 SLLGQMCVKPGQTKNTYRSGCFLLCNTGDKPV--FSRHG----------------LLTTVAYKLG 327
                    .||..|..........|:.|||.|  |.|.|                ||...||::.
Mouse   447 --------PPGTGKTLVARALANECSRGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMR 503

  Fly   328 PQAPTIYAIEGAVSVAGHALSWLQNKVRILPDSRDAEKYAEMVPTSGDVYFVPAFTGLYAPYWRQ 392
            |.......|:|...|.               .||..:.::.:|.|     .:....||       
Mouse   504 PAIIFFDEIDGLAPVR---------------SSRQDQIHSSIVST-----LLALMDGL------- 541

  Fly   393 NARG--IIIGLT--------------QFTR--------KNHIVRAALESICFQTRD--------I 425
            ::||  ::||.|              :|.|        ||    |..|.:...|||        .
Mouse   542 DSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKN----ARKEILKIHTRDWNPKPVDMF 602

  Fly   426 LECMHQE----CGYEINKLHADGKL------------TTNNLLMQLQADTIGMPVFRSQL 469
            ||.:.:.    ||.:|..:.|:..|            |:..|.:.|.:.||....|.:.|
Mouse   603 LEELAEHCVGYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSITISAKDFEAAL 662

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 110/568 (19%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 110/568 (19%)
Atad2NP_081711.2 AAA 438..579 CDD:214640 36/182 (20%)
AAA 443..577 CDD:278434 33/175 (19%)
Bromo_AAA 960..1070 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.