DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and katnal2

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001032491.1 Gene:katnal2 / 641431 ZFINID:ZDB-GENE-051113-156 Length:485 Species:Danio rerio


Alignment Length:247 Identity:53/247 - (21%)
Similarity:85/247 - (34%) Gaps:69/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KQLPEQGFSASDIVTVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQIVAKVQDPNHFR 157
            |:|.|||.|.. |.:.|   :|..|:        |..|::.....|  .||::..:|:...:..:
Zfish    91 KKLAEQGESRR-IKSCG---KRSHTL--------PRINSIQRPSSR--NTVKKSESKLTGRDFSK 141

  Fly   158 SSTGLPISTYFSALKIRWLRDNVPEVRQAIRE----RRCKAGTVDSWIVWNLTNGALHITDVTNA 218
            ||.|..::   ||..:.:..:..|.:|....|    |:.....:....|....|..||..|.|..
Zfish   142 SSDGDRLT---SADTLGFGLNVSPIIRNGAEEGTHMRKIDYRNLIQDAVRGAANDTLHNADFTEQ 203

  Fly   219 SRTLL-------MNLETQ-----------------AWDPVL----LKTFGIREEMLPTIHSCSEI 255
            .|.|.       ||.:.:                 .||.::    .|.. ::|.::..| ...::
Zfish   204 ERLLKPVSALIGMNSDMKELAAVISRDIYLHNPNVRWDDIIGLEAAKRL-VKEAVVYPI-KYPQL 266

  Fly   256 FGKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSGCFLLCNT 307
            |   |...||.:|:.|.|               .||..|..........|||
Zfish   267 F---TGILSPWKGLLLYG---------------PPGTGKTMLAKAVATECNT 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 53/247 (21%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 53/247 (21%)
katnal2NP_001032491.1 LisH 25..55 CDD:128913
P-loop_NTPase 242..>296 CDD:304359 13/73 (18%)
AAA 273..410 CDD:214640 10/43 (23%)
AAA 277..409 CDD:278434 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.