Sequence 1: | NP_001286904.1 | Gene: | Gk2 / 38221 | FlyBaseID: | FBgn0035266 | Length: | 576 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032491.1 | Gene: | katnal2 / 641431 | ZFINID: | ZDB-GENE-051113-156 | Length: | 485 | Species: | Danio rerio |
Alignment Length: | 247 | Identity: | 53/247 - (21%) |
---|---|---|---|
Similarity: | 85/247 - (34%) | Gaps: | 69/247 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 KQLPEQGFSASDIVTVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQIVAKVQDPNHFR 157
Fly 158 SSTGLPISTYFSALKIRWLRDNVPEVRQAIRE----RRCKAGTVDSWIVWNLTNGALHITDVTNA 218
Fly 219 SRTLL-------MNLETQ-----------------AWDPVL----LKTFGIREEMLPTIHSCSEI 255
Fly 256 FGKITSERSPLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSGCFLLCNT 307 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gk2 | NP_001286904.1 | glycerol_kin | 31..533 | CDD:273549 | 53/247 (21%) |
FGGY_GK1-3_metazoa | 31..533 | CDD:212664 | 53/247 (21%) | ||
katnal2 | NP_001032491.1 | LisH | 25..55 | CDD:128913 | |
P-loop_NTPase | 242..>296 | CDD:304359 | 13/73 (18%) | ||
AAA | 273..410 | CDD:214640 | 10/43 (23%) | ||
AAA | 277..409 | CDD:278434 | 8/39 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0554 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |