DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and PSMC1

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_002793.2 Gene:PSMC1 / 5700 HGNCID:9547 Length:440 Species:Homo sapiens


Alignment Length:189 Identity:43/189 - (22%)
Similarity:72/189 - (38%) Gaps:40/189 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 RTLLMNLETQAWDPVLLKTFGIR--EEMLPTIHSCSEIFGKITSER-SPLRGMTLSGIMGNQQA- 280
            |..|:.|| :..|.:|::...||  |:|.|......|...|:...| :|:...||..|:.:..| 
Human    59 RLKLLKLE-RIKDYLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNHAI 122

  Fly   281 -----------SLLGQMCVKPGQTKNTYRSGCFLLCNTGDKPVFSRHGLLTTVAYKLGPQAP--T 332
                       |:|..:      .|:....||.:|.|         |.:...:...:....|  |
Human   123 VSTSVGSEHYVSILSFV------DKDLLEPGCSVLLN---------HKVHAVIGVLMDDTDPLVT 172

  Fly   333 IYAIEGAVSVAGHALSWLQNKVRILPDSRD-----AEKYAEM--VPTSGDVYFVPAFTG 384
            :..:|.|.......:..|.|:::.:.:|.:     .|.|.||  .|..|.:.:.|..||
Human   173 VMKVEKAPQETYADIGGLDNQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 43/189 (23%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 43/189 (23%)
PSMC1NP_002793.2 PTZ00361 1..440 CDD:185575 43/189 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.