DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and ATAD2B

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_011531220.1 Gene:ATAD2B / 54454 HGNCID:29230 Length:1511 Species:Homo sapiens


Alignment Length:398 Identity:79/398 - (19%)
Similarity:127/398 - (31%) Gaps:117/398 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FSIYTTP-------DFKEIAAHRVELS-VITPQDGWYEQDPLEMMASINKCAEEAIKQLPEQGFS 101
            |:|::.|       |:.|:....::|| |||..|........:.:..|:.....|::..|::. .
Human   994 FNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKD-P 1057

  Fly   102 ASDIVTVGITNQRETTIVWDAVTGKPLYNALL--WKDIR----TSTTVEQIVAKVQDPNHFRSST 160
            ...|:.......::|.....|....|.:|.|.  .|:.|    .|.|.|||     :|:    ||
Human  1058 GDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKRGLSVTSEQI-----NPH----ST 1113

  Fly   161 GLPISTYFSALKIRWLRDNVPEVRQAIRERRCKAGTVDSWIVWNLTN------------------ 207
            |              .|.....|.:|.|.:  :...:|.|  .|..|                  
Human  1114 G--------------ARKTETRVEEAFRHK--QRNPMDVW--HNSANKCAFRVRRKSRRRSQWGK 1160

  Fly   208 GALHITDVTNASR----TLLMNLETQAWDPVLLKT--FGIREEMLPTIHSCSEIFGKITSERSPL 266
            |.:....|.|..:    |...:.|....|..||:.  |.:..:       |.|..|:.|.:.|..
Human  1161 GIIKKRKVNNLKKDEEDTKFADYENHTEDRKLLENGEFEVSTD-------CHEENGEETGDLSMT 1218

  Fly   267 ------------RGMTLSGIMGNQQ-----------ASLL--GQMCVKPGQT--KNTYRSGCFLL 304
                        :|..|:...|.::           .|||  ....:.|.||  |.|:..|   .
Human  1219 NDESSCDIMDLDQGQRLNNGAGTKENFASTEEESSNESLLVNSSSSLNPEQTSRKETFLKG---N 1280

  Fly   305 CNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSW--LQNKVRILPDSRDAEKYA 367
            |..|:....|..|:            |.:....|.:.|.....|.  ..::.:||.:.:..||..
Human  1281 CLNGEASTDSFEGI------------PVLECQNGKLEVVSFCDSGDKCSSEQKILLEDQSKEKPE 1333

  Fly   368 EMVPTSGD 375
            ......||
Human  1334 TSTENHGD 1341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 79/398 (20%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 79/398 (20%)
ATAD2BXP_011531220.1 AAA 447..588 CDD:214640
AAA 452..586 CDD:278434
COG5076 866..>1100 CDD:227408 22/106 (21%)
Bromo_AAA 974..1085 CDD:99957 18/91 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.