DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and kif23

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_012814357.1 Gene:kif23 / 496517 XenbaseID:XB-GENE-999865 Length:970 Species:Xenopus tropicalis


Alignment Length:202 Identity:43/202 - (21%)
Similarity:70/202 - (34%) Gaps:65/202 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 IVTVGITNQRETTIVWDAVTGKP------------LYNALLWKDIRTSTTVEQIVAKVQDPNHFR 157
            :.|.|:|...:|    ..:||.|            ::|::      .:...::.|.|..|.|   
 Frog   109 LFTYGVTGSGKT----HTMTGSPGDGGLLPRCLSMIFNSI------GNFQAKRYVFKPDDKN--- 160

  Fly   158 SSTGLPISTYFSALKIRWLRDNVPEV-------RQAIR---------ERRCKAGTVDSWIVWNLT 206
               |:.:.....||..|..|:..|::       ||.:.         :.:||...||...|:::.
 Frog   161 ---GMDVQNEVDALLERQKREVQPQLITRTPLSRQRMDPEFADMINIQEQCKVEDVDEDSVYSVF 222

  Fly   207 NGALHITDVTNASRTLLMNLETQAWDPVLLK--TFGIREEMLPT--------------IHSCSEI 255
            ...:.|  ..|....|   ||....||:..|  |.|...|.:|.              |..|:|:
 Frog   223 VSYIEI--YNNYIYDL---LEEVPLDPIKPKWNTPGRNAEFIPPQSRILREDLNHNMYIAGCTEV 282

  Fly   256 FGKITSE 262
            ..|.|.|
 Frog   283 EVKSTEE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 43/202 (21%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 43/202 (21%)
kif23XP_012814357.1 KISc_KIF23_like 25..448 CDD:276819 43/202 (21%)
CwlO1 543..>694 CDD:226400
PHA03307 <696..>821 CDD:223039
MKLP1_Arf_bdg 811..911 CDD:374613
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.