DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and Rpt6R

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_651811.1 Gene:Rpt6R / 43635 FlyBaseID:FBgn0039788 Length:399 Species:Drosophila melanogaster


Alignment Length:348 Identity:75/348 - (21%)
Similarity:120/348 - (34%) Gaps:82/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KNLPHSSA---DVPFRSKELRKQ-SLIQHTG---------------LVGVIDEG------TKTIG 44
            |||....|   ::..:.:.||:: .|:|..|               ||.|..||      .|||.
  Fly    34 KNLLRLQAQRNELNLKVRLLREELQLLQEQGSYIAEVVKPMDKNKVLVKVHPEGKYVVDVDKTIN 98

  Fly    45 FSIYTTPDFKEIAAHRVELSVITPQDGWYEQDPL--------------EMMASINKCAEEAIKQL 95
            ....|......:......|..|.|.    :.|||              ||:..::|..:| ||::
  Fly    99 IKDVTPSSRVALRNESYTLHKILPN----KVDPLVSLMLVEKVPDSTYEMVGGLDKQIQE-IKEV 158

  Fly    96 PEQGFSASDIV-TVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQIVAKVQDPNHFRSS 159
            .|......::. .:|||..:...:.....|||              |.:.:.||...:....|.|
  Fly   159 IELPVKHPELFDALGITQPKGVLLYGPPGTGK--------------TLLARAVAHHTECTFIRVS 209

  Fly   160 TGLPISTYF--SALKIRWL----RDNVPEV-----RQAIRERRCKAGTVDSWI---VWNLTNGAL 210
            ....:..:.  .:..:|.|    |::.|.:     ..:|...|.:.||.||.:   :..|.| .|
  Fly   210 GSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARLETGTGDSEVQRTMLELLN-QL 273

  Fly   211 HITDVTNASRTLLMNLETQAWDPVLLKTFGI--REEMLPTIHSCSEIFGKITSERSPL-RGMTLS 272
            ...:.|...:.::........|..||:...|  :.|..|..........||.|.:..| ||:.|.
  Fly   274 DGFEATKNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLR 338

  Fly   273 GIM----GNQQASLLGQMCVKPG 291
            .|.    |...|.:.| :|.:.|
  Fly   339 KIAEEMPGASGAEVKG-VCTEAG 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 67/318 (21%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 67/318 (21%)
Rpt6RNP_651811.1 RPT1 3..396 CDD:224143 75/348 (22%)
AAA 180..311 CDD:278434 27/145 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.