DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and Rpt2

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001287493.1 Gene:Rpt2 / 42828 FlyBaseID:FBgn0015282 Length:439 Species:Drosophila melanogaster


Alignment Length:221 Identity:45/221 - (20%)
Similarity:83/221 - (37%) Gaps:49/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 RERRCKAGTVDSWIVWNLTNGALHITDVT--NASRTLLMNLETQAWDPVLLKTFGIR--EEMLPT 248
            ::||.|.           .:.|:.:..||  ...|..|:.|| :..|.::::...||  |.:.|.
  Fly    35 KKRRAKG-----------PDAAMKLPQVTPHTRCRLKLLKLE-RIKDYLMMEDEFIRNQERLKPQ 87

  Fly   249 IHSCSEIFGKITSERSPLRGMTLSGIMGNQQ----------ASLLGQ---MCVKPGQTKNTYRSG 300
            .....|...|:    ..|||..:|  :||.:          ::.:|.   :.:.....|:....|
  Fly    88 DEKNEEERSKV----DDLRGTPMS--VGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPG 146

  Fly   301 CFLLCNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSWLQNKVRILPDSRD--- 362
            |.:|.|      ...|.::..::....|.. |:..:|.|.......:..|..:::.:.:|.:   
  Fly   147 CSVLLN------HKVHAVVGVLSDDTDPMV-TVMKLEKAPQETYADIGGLDTQIQEIKESVELPL 204

  Fly   363 --AEKYAEM--VPTSGDVYFVPAFTG 384
              .|.|.||  .|..|.:.:.|..||
  Fly   205 THPEYYEEMGIKPPKGVILYGPPGTG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 45/221 (20%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 45/221 (20%)
Rpt2NP_001287493.1 PTZ00361 1..439 CDD:185575 45/221 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.