DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and Rpt1

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_477473.1 Gene:Rpt1 / 35701 FlyBaseID:FBgn0028687 Length:433 Species:Drosophila melanogaster


Alignment Length:102 Identity:27/102 - (26%)
Similarity:38/102 - (37%) Gaps:33/102 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 GALHITDVTNASRTLLMNLETQAWDPVLLK--------TFGIREEMLPTIHSCSEIFGKITSERS 264
            |.:.:...||...||         ||.|::        .||     ||.....|.|| ||.:   
  Fly   313 GNIKVLMATNRPDTL---------DPALMRPGRLDRKVEFG-----LPDQDGRSHIF-KIHA--- 359

  Fly   265 PLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRSGC 301
              |.|:   :..:.:..||.::|  |..|....||.|
  Fly   360 --RSMS---VERDIRFDLLARLC--PNSTGAEIRSVC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 27/102 (26%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 27/102 (26%)
Rpt1NP_477473.1 RPT1 27..430 CDD:224143 27/102 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.