DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and psmc1a

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_956327.1 Gene:psmc1a / 336786 ZFINID:ZDB-GENE-030131-8730 Length:440 Species:Danio rerio


Alignment Length:271 Identity:59/271 - (21%)
Similarity:94/271 - (34%) Gaps:89/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 EEAIKQLPEQGFSASDIVTVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQIVAKVQDP 153
            :|.:|.|.|:              |.|.....|.:.|.|:          :..|:|:|:    |.
Zfish    82 QEQMKPLEEK--------------QEEERSKVDDLRGTPM----------SVGTLEEII----DD 118

  Fly   154 NHFRSSTGLPISTYFSALKIRWLRDNVPEVRQAIRERRCKAGTVDSWIVWNLTNGALH-----IT 213
            ||...||.:....|.|.|..         |.:.:.|..|..          |.|..:|     :.
Zfish   119 NHAIVSTSVGSEHYVSILSF---------VDKDLLEPGCSV----------LLNHKVHAVIGVLM 164

  Fly   214 DVTNASRTLLM-------------NLETQAWDPVLLKTFGIREEM-LPTIHSCSEIFGKITSERS 264
            |.|:...|::.             .|::|..:        |:|.: ||..|  .|.:.::..:  
Zfish   165 DDTDPLVTVMKVEKAPQETYADIGGLDSQIQE--------IKESVELPLTH--PEYYEEMGIK-- 217

  Fly   265 PLRGMTLSGIMGNQQASLLGQMCVKPGQTKNTYRS--GCFLLCN-TGDKPVFSRHGLLTTVAYKL 326
            |.:|:.|.|..|..:..|...:.   .||..|:..  |..|:.. .||.|...|.  |..||.: 
Zfish   218 PPKGVILYGAPGTGKTLLAKAVA---NQTSATFLRVVGSELIQKYLGDGPKLVRE--LFRVAEE- 276

  Fly   327 GPQAPTIYAIE 337
              .||:|..|:
Zfish   277 --HAPSIVFID 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 59/271 (22%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 59/271 (22%)
psmc1aNP_956327.1 PTZ00361 25..440 CDD:185575 59/271 (22%)
Prot_ATP_ID_OB 108..>176 CDD:293059 20/90 (22%)
AAA 222..355 CDD:278434 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.