DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and Atad2b

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001349278.1 Gene:Atad2b / 320817 MGIID:2444798 Length:1457 Species:Mus musculus


Alignment Length:377 Identity:74/377 - (19%)
Similarity:124/377 - (32%) Gaps:123/377 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FSIYTTP-------DFKEIAAHRVELS-VITPQDGWYEQDPLEMMASINKCAEEAIKQLPEQGFS 101
            |:|::.|       |:.|:....::|| |||..|........:.:..|:.....|::..|::. .
Mouse   979 FNIFSKPVDIEEVSDYLEVIKEPMDLSTVITKIDKHNYLTAKDFLQDIDLICSNALEYNPDKD-P 1042

  Fly   102 ASDIVTVGITNQRETTIVWDAVTGKPLYNALL--WKDIR----TSTTVEQIV----------AKV 150
            ...|:.......::|.....|....|.:|.|.  .|:.|    .|.|.|||.          .:|
Mouse  1043 GDKIIRHRACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKRGLSVTAEQITPHGAGARKTETRV 1107

  Fly   151 QDPNHFRSSTGLPISTYFS-----ALKIRWLRDNVPEVRQAIRERRCKAGTVDSWIVWN------ 204
            ::.  ||.....|:..:.:     |.::|         |::.|..:...|.:....|.|      
Mouse  1108 EEA--FRHKQRNPMDAWHNSANKCAFRVR---------RKSRRRSQWGKGIIKKRKVNNLKKDEE 1161

  Fly   205 ---------------LTNGALHI-TDV--TNASRT--LLMNLETQAWDPV-------LLKTFGIR 242
                           |.||...: ||.  .|...|  |.|..:..:.|.:       |....|.:
Mouse  1162 DTKFTDYDHTEDRKLLENGEFEVSTDCHEENGEETGDLSMTNDESSCDIMDMDQGQRLNSGAGTK 1226

  Fly   243 EEMLPT----------IHSCSEIFGKITSERSP-LRGMTLSG----------------------- 273
            |....|          :||.|.:..:.||::.| |:|..|:|                       
Mouse  1227 ENFASTEEESSNESLLVHSSSSLNPEQTSKKEPFLKGTCLNGEASTDSSEGIPVLECQNGRVLEV 1291

  Fly   274 ---------IMGNQQASLLGQMCVKPGQTKNTYRSGC-----FLLCNTGDKP 311
                     ....|:.:|..|:..|| :|.|..|...     .|.|::.:||
Mouse  1292 VPLPDGGEKSSSEQKIALEEQLKDKP-ETWNENRGDAAEKLEVLECSSSEKP 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 74/377 (20%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 74/377 (20%)
Atad2bNP_001349278.1 TIP49 <396..>668 CDD:332389
Bromo_AAA 959..1070 CDD:99957 18/91 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.