powered by:
Protein Alignment Gk2 and CG10793
DIOPT Version :9
Sequence 1: | NP_001286904.1 |
Gene: | Gk2 / 38221 |
FlyBaseID: | FBgn0035266 |
Length: | 576 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_570054.2 |
Gene: | CG10793 / 31308 |
FlyBaseID: | FBgn0029656 |
Length: | 479 |
Species: | Drosophila melanogaster |
Alignment Length: | 47 |
Identity: | 17/47 - (36%) |
Similarity: | 24/47 - (51%) |
Gaps: | 12/47 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 413 AALESIC-----FQT--RDILECMHQ---ECGY--EINKLHADGKLT 447
||.:.:| |.| |:||..||: |.|| ....|.::|:||
Fly 13 AAAQILCEDVRNFSTRRRNILYLMHRYLVENGYYASAESLKSEGRLT 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0554 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.