DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and CG10793

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_570054.2 Gene:CG10793 / 31308 FlyBaseID:FBgn0029656 Length:479 Species:Drosophila melanogaster


Alignment Length:47 Identity:17/47 - (36%)
Similarity:24/47 - (51%) Gaps:12/47 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 AALESIC-----FQT--RDILECMHQ---ECGY--EINKLHADGKLT 447
            ||.:.:|     |.|  |:||..||:   |.||  ....|.::|:||
  Fly    13 AAAQILCEDVRNFSTRRRNILYLMHRYLVENGYYASAESLKSEGRLT 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 17/47 (36%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 17/47 (36%)
CG10793NP_570054.2 LisH 31..56 CDD:285685 8/24 (33%)
P-loop_NTPase 205..>259 CDD:304359
AAA 238..376 CDD:214640
AAA 242..374 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.