DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and Katna1

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001004217.2 Gene:Katna1 / 292464 RGDID:1303062 Length:493 Species:Rattus norvegicus


Alignment Length:146 Identity:30/146 - (20%)
Similarity:62/146 - (42%) Gaps:30/146 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SKELRKQSLIQHTGLVGVI--DEGTKTIGFSIYTT-P-DFKEIAAHRVELSVITPQDGWYEQD-- 76
            |:.::.:.|:|..|:.|..  |:.:|.:.....|. | |..|....|:|..:..|......::  
  Rat   328 SRRVKAELLVQMDGVGGASENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREEL 392

  Fly    77 ------PLEMMASINKCAEEAIKQLPE--QGFSASDIVTVGITNQRETTIV-----WDAVTGKPL 128
                  .||:...:|      :..:.|  :|:|.:||..|    .|:.:::     .:.:|.:.:
  Rat   393 LRISLRELELADDVN------LASIAENMEGYSGADITNV----CRDASLMAMRRRIEGLTPEEI 447

  Fly   129 YNALLWKDIRTSTTVE 144
            .| |..:::...||:|
  Rat   448 RN-LSREEMHMPTTME 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 27/133 (20%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 27/133 (20%)
Katna1NP_001004217.2 AAA 243..384 CDD:214640 14/55 (25%)
AAA 247..383 CDD:278434 13/54 (24%)
Vps4_C <458..491 CDD:286426 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.