DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and Katnal1

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001006957.1 Gene:Katnal1 / 288449 RGDID:1359252 Length:488 Species:Rattus norvegicus


Alignment Length:302 Identity:60/302 - (19%)
Similarity:94/302 - (31%) Gaps:81/302 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 NGALH---ITDVTNASRTLLMNLETQAWDPVLLKTFGIREEMLPTIHSCSEIFGKITSERSPLRG 268
            |.::|   |.|:..|.:.|...:....|.|...|  |||.                     |.:|
  Rat   200 NPSIHWDDIADLEEAKKLLREAVVLPMWMPDFFK--GIRR---------------------PWKG 241

  Fly   269 MTLSGIMGNQQASLLGQMCVKPGQTKNTYRSGCFLLCNTGDKPVFSRHGLLTTVA--YKLGPQAP 331
            :.:.|..|..:..|...:..:.|.|.....|........|:.....|  ||..:|  |     ||
  Rat   242 VLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVR--LLFEMARFY-----AP 299

  Fly   332 TIYAIEGAVSVAGHALSWLQNKVRILPDSRDAEKYAE---MVPTSG-----------DVYFVPAF 382
            |...|:...|:...         |...|..:|.:..:   ::...|           .:..|.|.
  Rat   300 TTIFIDEIDSICSR---------RGTSDEHEASRRVKSELLIQMDGVGGALENDDPSKMVMVLAA 355

  Fly   383 TGLYAPYW-------RQNARGIIIGLTQFTRKNHIVRAALESI----CFQTRDILECMHQECGYE 436
            |..  | |       |:..:.|.|.|.....:..:::.:|..:    .....||.|......|.:
  Rat   356 TNF--P-WDIDEALRRRLEKRIYIPLPTAKGRAELLKISLREVELDPDIHLEDIAEKTEGYSGAD 417

  Fly   437 INKLHADGKLTT-----NNL----LMQLQADTIGMPVFRSQL 469
            |..:..|..|..     |.|    :..|..:.:.|||.|..|
  Rat   418 ITNICRDASLMAMRRRINGLSPEEIRALSKEELQMPVTRGDL 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 60/302 (20%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 60/302 (20%)
Katnal1NP_001006957.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..179
RecA-like_KTNA1 207..376 CDD:410930 40/210 (19%)
AAA_lid_3 400..444 CDD:407720 9/43 (21%)
Vps4_C <448..486 CDD:401324 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.