DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and wecF

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:YP_026257.1 Gene:wecF / 2847677 ECOCYCID:G7800 Length:359 Species:Escherichia coli


Alignment Length:277 Identity:51/277 - (18%)
Similarity:90/277 - (32%) Gaps:80/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 PTIY--AIEGAVS-------VAGHALSWLQNKVR---ILPDSRDAEKYAEMV-PTSGDVYFV--- 379
            ||::  .:.|.:.       :.|..|..|.:.:|   ..|..|.|:|....| .|.||:.|.   
E. coli    88 PTLWLALLSGGIKPSQFFWHIWGADLYELSSGLRYKLFYPLRRLAQKRVGCVFATRGDLSFFAKT 152

  Fly   380 ----------------PAFTGLYAPYWRQNARGIIIGLTQFTRKNHIVRAALESICFQTRDILEC 428
                            |:...:.....|:....|::|.:......||  |||.::          
E. coli   153 HPKVRGELLFFPTRMDPSLNTMANDRQREGKMTILVGNSGDRSNEHI--AALRAV---------- 205

  Fly   429 MHQECGYEINKLHADGKLTTNNLLMQLQADTIGMPVFRSQ----LMDSTAFGAAMCA-------- 481
             ||:.|..:..:...|....|...:: :....|:.:|..:    |.:...|.|.:..        
E. coli   206 -HQQFGDTVKVVVPMGYPPNNEAYIE-EVRQAGLELFSEENLQILSEKLEFDAYLALLRQCDLGY 268

  Fly   482 ---AQADGVNL----------CQFEPEKRYYENV--HYDTFLATTTDVERKERYGKWKRAVERSL 531
               |:..|:..          |....|..:::::  .:...|.||.|:..     ...|..:|.|
E. coli   269 FIFARQQGIGTLCLLIQAGIPCVLNRENPFWQDMTEQHLPVLFTTDDLNE-----DIVREAQRQL 328

  Fly   532 GWVIKQKKTREYTEENY 548
            ..|  .|.|..:...||
E. coli   329 ASV--DKNTIAFFSPNY 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 46/260 (18%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 46/260 (18%)
wecFYP_026257.1 Glyco_transf_56 1..356 CDD:400007 51/277 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.