powered by:
Protein Alignment Gk2 and rpt1
DIOPT Version :9
Sequence 1: | NP_001286904.1 |
Gene: | Gk2 / 38221 |
FlyBaseID: | FBgn0035266 |
Length: | 576 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_596805.1 |
Gene: | rpt1 / 2539862 |
PomBaseID: | SPBC16C6.07c |
Length: | 438 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 44 |
Identity: | 13/44 - (29%) |
Similarity: | 19/44 - (43%) |
Gaps: | 13/44 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 357 LPDSRDAEKYAEMVPT------------SGDVYFVPAF-TGLYA 387
:|...|.|||.:.|.| .||:..:.:: ||.||
pombe 1 MPPKEDWEKYQKPVDTEEENDKNPPPLDEGDIELLKSYATGPYA 44
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0554 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.