DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and rpt-1

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_506005.1 Gene:rpt-1 / 179641 WormBaseID:WBGene00004501 Length:435 Species:Caenorhabditis elegans


Alignment Length:96 Identity:24/96 - (25%)
Similarity:34/96 - (35%) Gaps:23/96 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YEQDP-LEMMASINKCAEEAIKQLPE-QGFSASDIVTVGITNQRETTIVWDAVTGK-------PL 128
            |.|.| .|.:.:::...|..:|::.| .|...||   .|:.    ...:||....|       ||
 Worm    38 YGQGPYAEQLKTLDADIENCLKKVNELSGVKESD---TGLA----PPALWDIAADKQAMQQEQPL 95

  Fly   129 YNALLWK-------DIRTSTTVEQIVAKVQD 152
            ..|...|       |.|....|:|....|.|
 Worm    96 QVARCTKIITSDKHDPRYLINVKQFAKFVVD 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 24/96 (25%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 24/96 (25%)
rpt-1NP_506005.1 RPT1 29..432 CDD:224143 24/96 (25%)
AAA 214..345 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.