powered by:
Protein Alignment Gk2 and rpt-2
DIOPT Version :9
Sequence 1: | NP_001286904.1 |
Gene: | Gk2 / 38221 |
FlyBaseID: | FBgn0035266 |
Length: | 576 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_504558.1 |
Gene: | rpt-2 / 178988 |
WormBaseID: | WBGene00004502 |
Length: | 443 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 29/71 - (40%) |
Gaps: | 8/71 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 FRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHRVELSVITPQDGWYEQDPLEM 80
||..|....|:: .||| ...:|...|.:....|....|..|.::...||:..:..:::
Worm 274 FRVAEENAPSIV-------FIDE-IDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKV 330
Fly 81 MASINK 86
:.:.|:
Worm 331 LMATNR 336
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0554 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.