DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and rpt-2

DIOPT Version :10

Sequence 1:NP_647655.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_504558.1 Gene:rpt-2 / 178988 WormBaseID:WBGene00004502 Length:443 Species:Caenorhabditis elegans


Alignment Length:71 Identity:15/71 - (21%)
Similarity:29/71 - (40%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHRVELSVITPQDGWYEQDPLEM 80
            ||..|....|::       .||| ...:|...|.:....|....|..|.::...||:..:..:::
 Worm   274 FRVAEENAPSIV-------FIDE-IDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKV 330

  Fly    81 MASINK 86
            :.:.|:
 Worm   331 LMATNR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_647655.1 glycerol_kin 31..533 CDD:273549 11/56 (20%)
rpt-2NP_504558.1 PTZ00361 1..443 CDD:185575 15/71 (21%)

Return to query results.
Submit another query.