DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and rpt-2

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_504558.1 Gene:rpt-2 / 178988 WormBaseID:WBGene00004502 Length:443 Species:Caenorhabditis elegans


Alignment Length:71 Identity:15/71 - (21%)
Similarity:29/71 - (40%) Gaps:8/71 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FRSKELRKQSLIQHTGLVGVIDEGTKTIGFSIYTTPDFKEIAAHRVELSVITPQDGWYEQDPLEM 80
            ||..|....|::       .||| ...:|...|.:....|....|..|.::...||:..:..:::
 Worm   274 FRVAEENAPSIV-------FIDE-IDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKV 330

  Fly    81 MASINK 86
            :.:.|:
 Worm   331 LMATNR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 11/56 (20%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 11/56 (20%)
rpt-2NP_504558.1 PTZ00361 1..443 CDD:185575 15/71 (21%)
Prot_ATP_ID_OB 112..>179 CDD:293059
AAA 225..358 CDD:278434 15/71 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.