DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and C10G11.8

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:NP_001379656.1 Gene:C10G11.8 / 172324 WormBaseID:WBGene00015688 Length:438 Species:Caenorhabditis elegans


Alignment Length:310 Identity:58/310 - (18%)
Similarity:104/310 - (33%) Gaps:111/310 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 TGLVGVIDE--GTKTIGFSIYTTP--DFKEIAA---------HRVELSVITPQDGWYEQDPLEMM 81
            :.:|||:|:  .:..:|..:..||  .|.:|..         ..|||.:..|:  :||:      
 Worm   155 SAIVGVLDDKIDSNAMGHKVEKTPKETFDDIGGCESQIQELKESVELPLTHPE--YYEE------ 211

  Fly    82 ASINKCAEEAIKQLPEQGFSASDIVTVGITNQRETTIVWDAVTGKPLYNALLWKDIRTSTTVEQI 146
                                      :|||..:...:..:..|||    .||.|.:..||:...|
 Worm   212 --------------------------MGITAPKGVILYGEPGTGK----TLLAKAVANSTSATFI 246

  Fly   147 VAKVQDPNHFRSSTGLPISTYFSALKIRWL----RDNVP------------------------EV 183
            .|...|....:|..|        |..:|.:    ::..|                        ||
 Worm   247 RATGSDLVQKQSGEG--------ARLVRQIFQMAKEQAPSIVFIDEIDAVGTKRFDTSSRGEQEV 303

  Fly   184 RQAIRERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLETQAWDPVLLKTFGIREEM--- 245
            ::.:.|...:....:|       .|.:.|...||...:|         ||.|::...|..::   
 Worm   304 QRTLLELLNQLDGFES-------RGDVKIIMATNRIDSL---------DPALIRPGRIDRKIELP 352

  Fly   246 LPTIHSCSEIFGKITSERSPLRGMTLSGIMGNQQASLLG----QMCVKPG 291
            .|...:..:||...||..:..:.:|...::|.:: |:.|    .:|.:.|
 Worm   353 KPDEKTRQKIFTIHTSGMTIQKAVTYENVLGKEK-SISGAEIKAVCTEAG 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 58/309 (19%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 58/309 (19%)
C10G11.8NP_001379656.1 PTZ00361 9..437 CDD:185575 58/310 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.