DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and AgaP_AGAP003215

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_312923.4 Gene:AgaP_AGAP003215 / 1273890 VectorBaseID:AGAP003215 Length:438 Species:Anopheles gambiae


Alignment Length:228 Identity:50/228 - (21%)
Similarity:85/228 - (37%) Gaps:47/228 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PEVRQAIRERRCKAGTVDSWIVWNLTNGALHITDVT--NASRTLLMNLETQAWDPVLLKTFGIR- 242
            |.:...:.:::.||...|:         ||.:..||  ...|..|:.|| :..|.:|::...|| 
Mosquito    25 PPIPTRVGKKKRKAKGPDA---------ALKLPQVTPHTRCRLKLLKLE-RIKDYLLMEEEFIRN 79

  Fly   243 -EEMLPTIHSCSEIFGKITSER-SPLRGMTLSGIMGNQQA------------SLLGQMCVKPGQT 293
             |.:.|......|...|:...| ||:...||..|:.:..|            |:|..:      .
Mosquito    80 QERLKPQEEKIEEERSKVDDLRGSPMSVGTLEEIIDDNHAIVSTSVGSEHYVSILSFV------D 138

  Fly   294 KNTYRSGCFLLCNTGDKPVFSRHGLLTTVAYKLGPQAPTIYAIEGAVSVAGHALSWLQNKVRILP 358
            |:....||.:|.|      ...|.::..:.....|.. |:..:|.|.......:..|..:::.:.
Mosquito   139 KDQLEPGCSVLLN------HKVHAVVGVLGDDTDPMV-TVMKLEKAPQETYADIGGLDTQIQEIK 196

  Fly   359 DSRD-----AEKYAEM--VPTSGDVYFVPAFTG 384
            :|.:     .|.|.||  .|..|.:.:.|..||
Mosquito   197 ESVELPLTHPEYYEEMGIKPPKGVILYGPPGTG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 50/228 (22%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 50/228 (22%)
AgaP_AGAP003215XP_312923.4 PTZ00361 1..438 CDD:185575 50/228 (22%)
Prot_ATP_ID_OB 106..>174 CDD:293059 14/80 (18%)
AAA 220..353 CDD:278434 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.