DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gk2 and AgaP_AGAP007243

DIOPT Version :9

Sequence 1:NP_001286904.1 Gene:Gk2 / 38221 FlyBaseID:FBgn0035266 Length:576 Species:Drosophila melanogaster
Sequence 2:XP_308557.2 Gene:AgaP_AGAP007243 / 1269903 VectorBaseID:AGAP007243 Length:403 Species:Anopheles gambiae


Alignment Length:252 Identity:52/252 - (20%)
Similarity:90/252 - (35%) Gaps:52/252 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DPL--------------EMMASINKCAEEAIKQLPEQGFSASDIV-TVGITNQRETTIVWDAVTG 125
            |||              ||:..::|..:| ||::.|......::. .:||...:...:.....||
Mosquito   129 DPLVSLMMVEKVPDSTYEMVGGLDKQIKE-IKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTG 192

  Fly   126 KPLYNALLWKDIRTSTTVEQIVAKVQDPNHFRSSTGLPISTYF--SALKIRWL----RDNVPEV- 183
            |              |.:.:.||...:....|.|....:..:.  .:..:|.|    |::.|.: 
Mosquito   193 K--------------TLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSII 243

  Fly   184 ----RQAIRERRCKAGTVDSWIVWNLTNGALHITDVTNASRTLLMNLET---QAWDPVLLKTFGI 241
                ..:|...|.::|:.....|.......|:..|...|::.:.:.:.|   ...||.||:...|
Mosquito   244 FMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRI 308

  Fly   242 --REEMLPTIHSCSEIFGKITSERSPL-RGMTLSGIM----GNQQASLLGQMCVKPG 291
              :.|..|..........||.|.:..| ||:.|..|.    |...|.:.| :|.:.|
Mosquito   309 DRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKG-VCTEAG 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gk2NP_001286904.1 glycerol_kin 31..533 CDD:273549 52/252 (21%)
FGGY_GK1-3_metazoa 31..533 CDD:212664 52/252 (21%)
AgaP_AGAP007243XP_308557.2 RPT1 15..401 CDD:224143 52/252 (21%)
AAA_16 150..>203 CDD:289934 13/67 (19%)
AAA 183..315 CDD:278434 26/145 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.