DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Gk2 and KATNA1

DIOPT Version :9

Sequence 1:	NP_001286904.1	Gene:	Gk2 / 38221	FlyBaseID:	FBgn0035266	Length:	576	Species:	Drosophila melanogaster
Sequence 2:	NP_008975.1	Gene:	KATNA1 / 11104	HGNCID:	6216	Length:	491	Species:	Homo sapiens

Alignment Length:	140	Identity:	28/140 - (20%)
Similarity:	62/140 - (44%)	Gaps:	18/140 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    18 SKELRKQSLIQHTGLVGVI--DEGTKTIGFSIYTT-P-DFKEIAAHRVELSVITPQDGWYEQDPL 78
            |:.::.:.|:|..|:.|..  |:.:|.:.....|. | |..|....|:|..:..|......::.|
Human   326 SRRVKAELLVQMDGVGGTSENDDPSKMVMVLAATNFPWDIDEALRRRLEKRIYIPLPSAKGREEL 390

  Fly    79 EMMA--SINKCAEEAIKQLPE--QGFSASDIVTVGITNQRETTIV-----WDAVTGKPLYNALLW 134
            ..::  .:....:..:..:.|  :|:|.:||..|    .|:.:::     .:.:|.:.:.| |..
Human   391 LRISLRELELADDVDLASIAENMEGYSGADITNV----CRDASLMAMRRRIEGLTPEEIRN-LSK 450

  Fly   135 KDIRTSTTVE 144
            :::...||:|
Human   451 EEMHMPTTME 460

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Gk2	NP_001286904.1	glycerol_kin	31..533	CDD:273549	25/127 (20%)
Gk2	NP_001286904.1	FGGY_GK1-3_metazoa	31..533	CDD:212664	25/127 (20%)
KATNA1	NP_008975.1	Interaction with microtubules	1..185
		Interaction with dynein and NDEL1. /evidence=ECO:0000250	1..75
		Interaction with KATNB1. /evidence=ECO:0000269\|PubMed:10751153	1..29
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	87..185
		AAA	241..382	CDD:214640	14/55 (25%)
		AAA	245..381	CDD:278434	13/54 (24%)
		Vps4_C	<456..489	CDD:286426	3/5 (60%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0554
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900