DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Tie1

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_445997.1 Gene:Tie1 / 89806 RGDID:621642 Length:1137 Species:Rattus norvegicus


Alignment Length:218 Identity:61/218 - (27%)
Similarity:78/218 - (35%) Gaps:87/218 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 CPVGSYGPGCQESCE-CYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAM 324
            |..|.:||||.:.|. |..|..||...|:|.||||:.|.||                        
  Rat   216 CEAGRWGPGCVKDCPGCLHGGVCHDHDGECVCPPGFTGTRC------------------------ 256

  Fly   325 CDRANGTCICNPGWTGAKCAERICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQC 389
                                |:.|...::|..|...|           |.|..|           
  Rat   257 --------------------EQACREGRFGQSCQEQC-----------PGTAGC----------- 279

  Fly   390 TRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNG 454
             |..||                  |.|....|.|..||||..|:|:|.||.||.||.|:|.||||
  Rat   280 -RGLTF------------------CLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNG 325

  Fly   455 AKCEPETGQCLCTAGWKNIKCDR 477
            ..|:..:| |:|.:||..:.|::
  Rat   326 GTCDRFSG-CVCPSGWHGVHCEK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 14/45 (31%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Tie1NP_445997.1 ig 130..211 CDD:278476
EGF_Lam 228..266 CDD:238012 16/81 (20%)
EGF_CA 315..346 CDD:238011 14/31 (45%)
ig 357..442 CDD:278476
IG_like 370..444 CDD:214653
fn3 450..530 CDD:278470
fn3 549..631 CDD:278470
FN3 643..735 CDD:238020
PTKc_Tie1 835..1131 CDD:270671
TyrKc 838..1106 CDD:197581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.