DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Fgfr3

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_006251452.1 Gene:Fgfr3 / 84489 RGDID:620714 Length:804 Species:Rattus norvegicus


Alignment Length:299 Identity:63/299 - (21%)
Similarity:88/299 - (29%) Gaps:99/299 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   742 PEGFYGEHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDELIASQRIADQSENSSRASVALTLV 806
            |.|.  ::..:.|..|.....|.....|    .|......|.:|||:...:       .:|...|
  Rat   570 PPGM--DYSFDACRLPEEQLTCKDLVSC----AYQVARGMEYLASQKCIHR-------DLAARNV 621

  Fly   807 LMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHDTN---PPSW-PPNHNFDNPVYGMQAETRLL 867
            |:|....:..|.| ...|.|.||.      :|...||   |..| .|...||. ||..|::    
  Rat   622 LVTEDNVMKIADF-GLARDVHNLD------YYKKTTNGRLPVKWMAPEALFDR-VYTHQSD---- 674

  Fly   868 PNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDLLTK--NLNADRTNPIVYNE---S 927
                                          |.|:.:     ||.:  .|.......|...|   .
  Rat   675 ------------------------------VWSFGV-----LLWEIFTLGGSPYPGIPVEELFKL 704

  Fly   928 LKEEHVYD--------------EIKH-----KEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQK 973
            |||.|..|              |..|     :..:|..|:...:||......::||.|.|.....
  Rat   705 LKEGHRMDKPANCTHDLYMIMRECWHAVPSQRPTFKQLVEDLDRILTVTSTDEYLDLSVPFEQYS 769

  Fly   974 PHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKPLPPTEP 1012
            |.           .||....|:..:.:|..:..|||..|
  Rat   770 PG-----------GQDTPSSSSSGDDSVFTHDLLPPGPP 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Fgfr3XP_006251452.1 IGc2 51..108 CDD:197706
IG 52..123 CDD:214652
Ig2_FGFR 155..239 CDD:143265
IG_like 254..349 CDD:214653
Ig3_FGFR 262..350 CDD:143175
PTKc_FGFR3 457..790 CDD:173652 59/290 (20%)
Pkinase_Tyr 470..746 CDD:285015 48/235 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.