DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Tnfaip6

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_445834.1 Gene:Tnfaip6 / 84397 RGDID:621359 Length:275 Species:Rattus norvegicus


Alignment Length:267 Identity:49/267 - (18%)
Similarity:73/267 - (27%) Gaps:115/267 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 AKCEPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTCAAGWTGERCE 519
            |.||.|.|:   .|.:|.::..|            |:             |...|||||..:   
  Rat    56 AVCEYEGGR---LATYKQLEAAR------------KI-------------GFHVCAAGWMAK--- 89

  Fly   520 RKCDTGKFGHDCAQK-CQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYG------ENCD 577
                 |:.|:...:. ..|.|..:...|                         ||      |..|
  Rat    90 -----GRVGYPIVKPGPNCGFGKTGIID-------------------------YGIRLNRSERWD 124

  Fly   578 KVCRCLNNSSCDPDSGNCICSAGWTGADCAEP----CPPGFYGMECKERCPEILHGNKSCD-HIT 637
            ..|       .:|::..|       |....:|    ..|||         |.....|:.|. ||.
  Rat   125 AYC-------YNPNAKEC-------GGVFTDPKRIFKSPGF---------PNEYDDNQVCYWHIR 166

  Fly   638 ---GEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHGGECNHVTGQCQCLPGWTGSNCNESCP 699
               |:.: ...::....||       .|||.        .:...:......:.|:.|..|.:..|
  Rat   167 LKYGQRI-HLSFLDFDLEH-------DPGCL--------ADYVEIYDSYDDVHGFVGRYCGDELP 215

  Fly   700 TDTYGQG 706
            .|....|
  Rat   216 EDIISTG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 7/38 (18%)
DSL <567..606 CDD:302925 8/44 (18%)
Tnfaip6NP_445834.1 Link_domain_TSG_6_like 36..128 CDD:239592 25/139 (18%)
CUB 135..244 CDD:395345 23/120 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.