DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and TEK

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_000450.3 Gene:TEK / 7010 HGNCID:11724 Length:1124 Species:Homo sapiens


Alignment Length:272 Identity:78/272 - (28%)
Similarity:111/272 - (40%) Gaps:52/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 RICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCN--- 407
            |.|||.|:|.:||..|...| :..:||.:||.|.|..|:....|.:.|....:|..|:..|:   
Human   209 RRCEAQKWGPECNHLCTACM-NNGVCHEDTGECICPPGFMGRTCEKACELHTFGRTCKERCSGQE 272

  Fly   408 -CKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWK 471
             ||:...|.|....|.||.||:|..|.|:|.||.:|.||.|||.|.||..|:...| |||:.||:
Human   273 GCKSYVFCLPDPYGCSCATGWKGLQCNEACHPGFYGPDCKLRCSCNNGEMCDRFQG-CLCSPGWQ 336

  Fly   472 NIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTC-AAGW---TGERCERKCDTGKFGHDCA 532
            .::|:|    ....:...|:.|..::...|....:..| |:||   |.|........|...|   
Human   337 GLQCER----EGIQRMTPKIVDLPDHIEVNSGKFNPICKASGWPLPTNEEMTLVKPDGTVLH--- 394

  Fly   533 QKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCIC 597
               ..|||:                           :.::......:.|.|     .||||..:|
Human   395 ---PKDFNH---------------------------TDHFSVAIFTIHRIL-----PPDSGVWVC 424

  Fly   598 SAGWTGADCAEP 609
            |.........:|
Human   425 SVNTVAGMVEKP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 9/42 (21%)
DSL <567..606 CDD:302925 8/38 (21%)
TEKNP_000450.3 Ig_Tie2_1 24..118 CDD:402176
EGF_Lam 230..275 CDD:238012 12/44 (27%)
EGF_Lam 314..>342 CDD:238012 13/28 (46%)
IgI_Tie2 348..439 CDD:409556 23/127 (18%)
Ig strand B 366..370 CDD:409556 0/3 (0%)
Ig strand C 382..386 CDD:409556 0/3 (0%)
Ig strand E 407..411 CDD:409556 0/3 (0%)
Ig strand F 421..426 CDD:409556 1/4 (25%)
Ig strand G 434..437 CDD:409556 1/3 (33%)
fn3 445..520 CDD:394996
fn3 544..626 CDD:394996
FN3 639..731 CDD:238020
PTKc_Tie2 816..1118 CDD:133219
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.