Sequence 1: | NP_001261276.1 | Gene: | drpr / 38218 | FlyBaseID: | FBgn0027594 | Length: | 1042 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000450.3 | Gene: | TEK / 7010 | HGNCID: | 11724 | Length: | 1124 | Species: | Homo sapiens |
Alignment Length: | 272 | Identity: | 78/272 - (28%) |
---|---|---|---|
Similarity: | 111/272 - (40%) | Gaps: | 52/272 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 346 RICEANKYGLDCNRTCECDMEHTDLCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCN--- 407
Fly 408 -CKNGAKCSPVNGTCLCAPGWRGPTCEESCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAGWK 471
Fly 472 NIKCDRPCDLNHFGQDCAKVCDCHNNAACNPQNGSCTC-AAGW---TGERCERKCDTGKFGHDCA 532
Fly 533 QKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCIC 597
Fly 598 SAGWTGADCAEP 609 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drpr | NP_001261276.1 | EMI | 27..92 | CDD:284877 | |
EGF_CA | 274..319 | CDD:304395 | |||
DSL | <479..518 | CDD:302925 | 9/42 (21%) | ||
DSL | <567..606 | CDD:302925 | 8/38 (21%) | ||
TEK | NP_000450.3 | Ig_Tie2_1 | 24..118 | CDD:402176 | |
EGF_Lam | 230..275 | CDD:238012 | 12/44 (27%) | ||
EGF_Lam | 314..>342 | CDD:238012 | 13/28 (46%) | ||
IgI_Tie2 | 348..439 | CDD:409556 | 23/127 (18%) | ||
Ig strand B | 366..370 | CDD:409556 | 0/3 (0%) | ||
Ig strand C | 382..386 | CDD:409556 | 0/3 (0%) | ||
Ig strand E | 407..411 | CDD:409556 | 0/3 (0%) | ||
Ig strand F | 421..426 | CDD:409556 | 1/4 (25%) | ||
Ig strand G | 434..437 | CDD:409556 | 1/3 (33%) | ||
fn3 | 445..520 | CDD:394996 | |||
fn3 | 544..626 | CDD:394996 | |||
FN3 | 639..731 | CDD:238020 | |||
PTKc_Tie2 | 816..1118 | CDD:133219 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0200 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |