| Sequence 1: | NP_001261276.1 | Gene: | drpr / 38218 | FlyBaseID: | FBgn0027594 | Length: | 1042 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_081116.3 | Gene: | Pdgfrl / 68797 | MGIID: | 1916047 | Length: | 375 | Species: | Mus musculus |
| Alignment Length: | 225 | Identity: | 40/225 - (17%) |
|---|---|---|---|
| Similarity: | 66/225 - (29%) | Gaps: | 84/225 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 861 QAETRLLPNNMRSK---MNNFDQRSTMSTDYGD----DCNASGRVGSYSINYNHDLLTKNLNADR 918
Fly 919 TNPI------------VYNESLKEEHVYDEIKHKEGY---------------------------- 943
Fly 944 -KDPVKIYSKILF---------PEDEYDHLDYSRP-----------STSQKPHYHRMNDAMLNIN 987
Fly 988 QDEEKPSNVKNMTVLLNKPLPPTEPEPQHE 1017 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| drpr | NP_001261276.1 | EMI | 27..92 | CDD:284877 | |
| EGF_CA | 274..319 | CDD:304395 | |||
| DSL | <479..518 | CDD:302925 | |||
| DSL | <567..606 | CDD:302925 | |||
| Pdgfrl | NP_081116.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 20..63 | 11/29 (38%) | |
| Ig | 80..143 | CDD:299845 | 9/64 (14%) | ||
| IG_like | 83..>143 | CDD:214653 | 9/61 (15%) | ||
| I-set | 272..373 | CDD:254352 | |||
| Ig | 293..372 | CDD:299845 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0200 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||