DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and RET

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_066124.1 Gene:RET / 5979 HGNCID:9967 Length:1114 Species:Homo sapiens


Alignment Length:398 Identity:82/398 - (20%)
Similarity:122/398 - (30%) Gaps:139/398 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KRRE--------LYNVDVV---------YTELQSFQERGSTWCVTFPPRCSTYRIKHRVVNKTKT 77
            ||:|        :::.|||         ||   |....|.||..      .|:|::| ..|:|..
Human   286 KRKEDTVVATLRVFDADVVPASGELVRRYT---STLLPGDTWAQ------QTFRVEH-WPNETSV 340

  Fly    78 IAKNRIVRDCCDGYIASAGECVPHCSEPCQHGRCISPEKCKCDHGYGGPACDI-----NCP---- 133
            .|....||.....|     ..|.:.:......|.:.......|..:.||...:     |..    
Human   341 QANGSFVRATVHDY-----RLVLNRNLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPV 400

  Fly   134 ----PGWYGRNCSMQCD--------CLNNAVCEPFSG-DCECAKGYTGARCADI-------CPEG 178
                |..|..:.|.:..        |:.|  |:.||| :.:.....:||.|:.:       ...|
Human   401 SLHLPSTYSLSVSRRARRFAQIGKVCVEN--CQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSG 463

  Fly   179 FFGANCSEKCRCENGGKCHHV----------SGECQCAPGFTGPL------CDMRCPDGKHGAQC 227
            ....|.::..|.....:.|::          ..:.|......|..      |.:.|...|...:|
Human   464 ILFVNDTKALRRPKCAELHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLEC 528

  Fly   228 QQDCPC-------------QNDGK--------CQPETGAC---MCNPGWTGDVCANKCP------ 262
            ::   |             |.|||        |.|.|..|   .|:...|.|:  |.||      
Human   529 EE---CGGLGSPTGRCEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDI--NICPQDCLRG 588

  Fly   263 --VGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMC 325
              ||.:.||..      :|....:  |.|.|.|  ..|:||.|             .:...|.:|
Human   589 SIVGGHEPGEP------RGIKAGY--GTCNCFP--EEEKCFCE-------------PEDIQDPLC 630

  Fly   326 DRANGTCI 333
            |....|.|
Human   631 DELCRTVI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 20/78 (26%)
EGF_CA 274..319 CDD:304395 9/44 (20%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
RETNP_066124.1 Cadherin 172..261 CDD:278457
PTKc_RET 723..1012 CDD:173631
Pkinase_Tyr 724..1005 CDD:285015
Inhibitors binding 805..807
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.