DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and si:ch73-206d17.1

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_689652.2 Gene:si:ch73-206d17.1 / 561155 ZFINID:ZDB-GENE-090313-143 Length:393 Species:Danio rerio


Alignment Length:285 Identity:50/285 - (17%)
Similarity:92/285 - (32%) Gaps:95/285 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   767 HGCVCRSGYTGDNCDELIASQRIADQSENSSRASVALTLVL----MTLFACIIFAVFIYYRRRVS 827
            :|.:|......||....:..:.:.|:|..|..|.. :.|||    ::....|:..:|...||...
Zfish   109 YGPICMGQLKQDNTSTAVMIKTLKDRSTQSESAEF-MDLVLFHAAVSKHENIVKLLFCQTRRTPM 172

  Fly   828 NLKTEIAHVHYTHDTNPPSWPPN--------------------------------------HNFD 854
            .|..|            .|.|.|                                      |:..
Zfish   173 YLLLE------------ASVPGNLLNFLWSLREDRCGESSVFSEKSVFLVAKQIAAGLDYLHSHH 225

  Fly   855 NPVYG-MQAETRLLPNNMRSKMNN----FDQRSTMSTDYGDDCNASGR----------------- 897
            ..::| :.|...|:.:....|::.    |:.|.....|...:.|...:                 
Zfish   226 RVIHGDVAARNMLIGSAFSVKVSGLDFAFESRQKKKVDREQEANVPVKWQAPERMMRLPLTDRSD 290

  Fly   898 VGSYSINYNHDLLT------KNLNADRTNP--IVYNESLKEEH----VYDEIKH--KEGYKD-PV 947
            |.|:.| ..::::|      .:|:.....|  :.:....:.|:    ::|.||:  ...:|| ||
Zfish   291 VWSFGI-LLYEMITLGSPPYPDLDPSEVLPRTLAHYRMKRPENCGAPLFDLIKYCCMWNFKDRPV 354

  Fly   948 KIYSKILFPEDEYDHLDYSRPSTSQ 972
              ||.|:...|.|.:...::|..|:
Zfish   355 --YSAIIRLLDSYSYFADTKPLCSE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
si:ch73-206d17.1XP_689652.2 PKc_like 102..363 CDD:304357 46/269 (17%)
Pkinase_Tyr 102..362 CDD:285015 46/268 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.