DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and flt1

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001014829.3 Gene:flt1 / 544667 ZFINID:ZDB-GENE-050407-1 Length:1272 Species:Danio rerio


Alignment Length:408 Identity:77/408 - (18%)
Similarity:126/408 - (30%) Gaps:151/408 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 VTGQCQCLPGWTGSNCNESCPTDTYGQGCAQRC---RCVHHKVCRKADGMCICETGWSG--TRCD 738
            |..||       |...|:.|...|......|..   ||.:.:..||...:.|..|....  .:..
Zfish    75 VNTQC-------GKKSNQYCSRLTLSPALTQHTGSYRCRYRQKERKQTSVYIYITDSQRPFVKVQ 132

  Fly   739 EVCPEGFY---GEHCMNTCAC--PSA-----NFQCHAAHGCVCRSGYTGDNCDELIASQRIADQS 793
            ...|:..|   ||..:..|..  |.|     .|..|                       ||....
Zfish   133 SEIPDVVYMKEGEPLVFPCRVTNPDAKVSLVKFPLH-----------------------RITPDH 174

  Fly   794 EN---SSRASVAL---TLVLMTLFACIIFAVFIYYRRRVSNLKTEIAHVHYTHD--TNPPSWPPN 850
            .|   :||....:   |...:.||:|                :|.:..|.||:.  |:.   |.|
Zfish   175 RNIIWNSRQGFIIRSPTFFYIGLFSC----------------ETIVDGVKYTNKFLTHR---PVN 220

  Fly   851 H------NFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNHDL 909
            .      |....|:.:|.|...|...:.::.|:   |.::|..|....|.|.            :
Zfish   221 KILDVYLNSTGLVHTLQGEMLALNCTVTAEWNS---RVSISWTYPQKANGSA------------I 270

  Fly   910 LTKNLNADRTNPIVYN----------------------ESLKEEH----VYDE----IKHKEGYK 944
            ::|.::..|:|.:.|:                      .|.:|.:    |||:    :||:.|  
Zfish   271 ISKRISRSRSNMLFYSVLTIPSLSKADKGLYKCQVTSGPSKRETNTTVIVYDQPFIRLKHRNG-- 333

  Fly   945 DPV----------KIYSKI-LFPEDEYDHLDYSRPSTSQKPHYHRMNDAMLNINQDEEKPSNV-- 996
             ||          ::..|: .||..|...|.....:..:...|| ::...|.|....|:.:.:  
Zfish   334 -PVVQAFAGQKSFRLTPKLKAFPAPEIIWLKDGMVAAERCSRYH-VDGFSLVIRDVAEEDAGIYT 396

  Fly   997 -----------KNMTVLL 1003
                       :|:|:.|
Zfish   397 ILTGIQQYGLFQNLTITL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
flt1NP_001014829.3 Ig 238..321 CDD:386229 14/97 (14%)
Ig_VEGFR-1 345..416 CDD:143326 13/71 (18%)
Ig_3 426..529 CDD:372822
IG 558..646 CDD:214652
I-set 650..733 CDD:369462
PTKc_VEGFR 809..1138 CDD:270647
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.