DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and FGFRL1

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:XP_024309860.1 Gene:FGFRL1 / 53834 HGNCID:3693 Length:527 Species:Homo sapiens


Alignment Length:211 Identity:47/211 - (22%)
Similarity:76/211 - (36%) Gaps:38/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   723 DGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCHAAHGCVCRS-GYTGDNCDELI-A 785
            ||..| .:|||..|   |.|:|...:......|   ..:.|.|.:|....| .||....|::. .
Human    89 DGRTI-HSGWSRFR---VLPQGLKVKQVEREDA---GVYVCKATNGFGSLSVNYTLVVLDDISPG 146

  Fly   786 SQRIADQSENSSRASVALTLVLMTLFACIIFAVFIYYRRRV------SNLKTE-IAHVHYTHDTN 843
            .:.:...|.:..:...|     ...:|...|......||||      |:::.: :|..|...|. 
Human   147 KESLGPDSSSGGQEDPA-----SQQWARPRFTQPSKMRRRVIARPVGSSVRLKCVASGHPRPDI- 205

  Fly   844 PPSWPPNHNFDNPVYGMQAETRLLPNNMRSKMNNFDQRSTMSTDYGD-DCNASGRVGSYSINYNH 907
              :|..:.         ||.||......|.|......::....|.|. .|..|.|.|:.:..|..
Human   206 --TWMKDD---------QALTRPEAAEPRKKKWTLSLKNLRPEDSGKYTCRVSNRAGAINATYKV 259

  Fly   908 DLLTKNLNADRTNPIV 923
            |::.:.    |:.|::
Human   260 DVIQRT----RSKPVL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
FGFRL1XP_024309860.1 I-set 56..139 CDD:254352 17/56 (30%)
Ig2_FGFRL1-like 180..261 CDD:143264 21/92 (23%)
Ig 284..378 CDD:325142
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.