Sequence 1: | NP_001261276.1 | Gene: | drpr / 38218 | FlyBaseID: | FBgn0027594 | Length: | 1042 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359002.1 | Gene: | PDGFRL / 5157 | HGNCID: | 8805 | Length: | 375 | Species: | Homo sapiens |
Alignment Length: | 239 | Identity: | 40/239 - (16%) |
---|---|---|---|
Similarity: | 68/239 - (28%) | Gaps: | 91/239 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 848 PPNHNFDNPVYGMQAETRLLPNN--MRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSI------N 904
Fly 905 YNHDLLTKNLNADRTNPI------------VYNESLKEEHVYDEIKHKEGY-------------- 943
Fly 944 ---------------KDPVKIYSKILF---------PEDEYDHLDYSRPS-----------TSQK 973
Fly 974 PHYHRMNDAMLNINQDEEKPSNVKNMTVLLNKPLPPTEPEPQHE 1017 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drpr | NP_001261276.1 | EMI | 27..92 | CDD:284877 | |
EGF_CA | 274..319 | CDD:304395 | |||
DSL | <479..518 | CDD:302925 | |||
DSL | <567..606 | CDD:302925 | |||
PDGFRL | NP_001359002.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 22..64 | 11/51 (22%) | |
IG_like | 83..145 | CDD:214653 | 9/63 (14%) | ||
Ig | 293..372 | CDD:386229 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0200 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |