DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Dkk4

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001102802.1 Gene:Dkk4 / 502097 RGDID:1563172 Length:221 Species:Rattus norvegicus


Alignment Length:224 Identity:55/224 - (24%)
Similarity:80/224 - (35%) Gaps:58/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 AKVCDCHNNAACNPQNGSCTCAAGWTGERC--ERKCDTGKFG---HD----CA------QKCQCD 538
            |.|.|.:|..:.:...||      ..|.:|  ::.|:.|||.   ||    ||      ::||  
  Rat    18 ALVLDFNNIKSSSDVQGS------GKGSQCVSDKDCNVGKFCFALHDERSFCATCRRVRRRCQ-- 74

  Fly   539 FNNSLACDAT---NGRCVCKQDWGGV-HCETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSA 599
             .:::.|..|   |..|...::...| ...|:.:.|.|.|...|.....|.....|.:.....:.
  Rat    75 -RSAMCCPGTVCVNDVCTAVENTRPVMDRNTDGQDGTYAEGTTKWPAEENRPQGKPSTKKSQSNK 138

  Fly   600 GWTGADC--AEPCPPG------FYGMECKERCPEILHGNKSCDHITGEILCRTGYIGLTCEHPCP 656
            |..|..|  ...|.||      |:...||   |.:|.         |::..|.|       |...
  Rat   139 GQEGESCLRTSDCGPGLCCARHFWTKICK---PVLLE---------GQVCSRRG-------HKDT 184

  Fly   657 AGLYGPGCKLKCNCEHGGEC-NHVTGQCQ 684
            |  ..|....:|:|..|..| :.|||..|
  Rat   185 A--QAPEIFQRCDCGPGLSCRSQVTGNRQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 7/28 (25%)
DSL <567..606 CDD:302925 8/38 (21%)
Dkk4NP_001102802.1 Dickkopf_N 41..91 CDD:282549 14/52 (27%)
Prokineticin <145..202 CDD:148298 18/77 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.