DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and htl

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster


Alignment Length:320 Identity:64/320 - (20%)
Similarity:102/320 - (31%) Gaps:113/320 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   772 RSGYTGDNCDELIASQRIADQSENSSRASVALTLVLMTLFACI-----IFAVFIYYRRRVSNLKT 831
            :.|:|.|:...|:....:        ...:...:.::.|..|.     ::.:..|...  .|||.
  Fly   446 KEGHTDDDIASLVREMEV--------MKIIGRHINIINLLGCCSQNGPLYVIVEYAPH--GNLKD 500

  Fly   832 EIAHVHYTH----------DTNPPSWPPNH--------NFDNPV-YGMQ-------------AET 864
            .:    |.:          .:.||..||.|        .|.:.: .||.             |..
  Fly   501 FL----YKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARN 561

  Fly   865 RLLPNNMRSKMNNFD-QRSTMSTDYGDDCNASGRVGSYSINYNHDLLTKNLNADRTNPIVY--NE 926
            .|:.::...|:.:|. .|...||||            |..|.|..|           ||.:  .|
  Fly   562 VLVSDDYVLKIADFGLARDIQSTDY------------YRKNTNGRL-----------PIKWMAPE 603

  Fly   927 SLKEEHVYDEIKHKEGY-----------KDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHYHRMN 980
            ||:|: .||.......|           :.|   |..|:..|:.|.:|  ......:||....||
  Fly   604 SLQEK-FYDSKSDVWSYGILLWEIMTYGQQP---YPTIMSAEELYTYL--MSGQRMEKPAKCSMN 662

  Fly   981 DAML-----NINQDEEKPSN--VKNMTVLL------------NKPLPPTEPEPQHECFDN 1021
            ..:|     :.|.|:..|..  |:.|..||            |...||:..:.:.:..||
  Fly   663 IYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKEDYLDVDIANLDTPPSTSDEEEDETDN 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
htlNP_524394.2 Ig 112..191 CDD:299845
IG_like 113..191 CDD:214653
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357 57/288 (20%)
STYKc 416..688 CDD:214568 56/284 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.