DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and CG17147

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:462 Identity:96/462 - (20%)
Similarity:135/462 - (29%) Gaps:170/462 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 EKCRC-ENGGKCHHVSGECQCAPGFTGPLCD--MRCPDGKHGAQCQQDCPCQNDGKCQPETGACM 247
            |.||. :||.|..        .||    .||  ::|.||....     ..|.::....|..|:|:
  Fly    30 ELCRLFKNGTKVR--------KPG----TCDQYIQCYDGNGTV-----LTCPSNQSFNPSKGSCV 77

  Fly   248 CNPGWTGDVCANKCPVGSYGPGCQESCECYK------GAPCHHITGQCECPPGYRGERCFDECQL 306
            .....:...|.|:|. |..|....:..||:|      |.|   :.|.  ||.|..    |||   
  Fly    78 DTLANSNKYCGNRCE-GLDGEWVADPTECHKYFYCMNGVP---LAGM--CPVGQH----FDE--- 129

  Fly   307 NTYGFNCSMTCDCANDAMCDRANGTCICNPGWTGAKCAERICEANKY--GLDCNRTCECDMEHTD 369
                  .|.:|....|:||...|..|            |.:.|..|:  ..||....|||     
  Fly   130 ------RSQSCLYGVDSMCVDVNNIC------------ELVAENTKFRNEKDCAYYYECD----- 171

  Fly   370 LCHPETGNCQCSIGWSSAQCTRPCTFLRYGPNCELTCNCKNGAKCSPVNGTCLCAPGWRGPTCEE 434
                :|||          ..::.|           |...|........:|.|:.|          
  Fly   172 ----KTGN----------HASKSC-----------TVTSKKREYFDVESGNCVEA---------- 201

  Fly   435 SCEPGTFGQDCALRCDCQNGAKCEPETGQCLCTAG-WKNIKCDRPCDLNHFGQDCAKVCDC-HNN 497
                              |..:|...:.:.:||:. ....|.|:.....:|      ||.. :..
  Fly   202 ------------------NKVECTAHSKENVCTSSTTMTFKSDQATCRGYF------VCKALYPV 242

  Fly   498 AACNPQNGSCTCAAGWTGERCERKCDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVH 562
            |..:|.         ||      :|..|.|..:..|.|.    |......|:.||    |..|..
  Fly   243 ADLDPL---------WT------QCPEGYFFDEDRQLCA----NPTTVVCTHNRC----DGRGTM 284

  Fly   563 CETNCRSGYYGENCDKVCRCLNNSSCDPDSGNCICSAGWTGADCAEPCPPGFYGMECKERCPEIL 627
            ..|:.     ..||....||::|...                 ..|.|....:..|..|.|...:
  Fly   285 LVTSS-----SNNCHNYIRCVDNKEV-----------------TEETCHWDHFFDETVEACSSKI 327

  Fly   628 HGNKSCD 634
            ..:|.||
  Fly   328 IYDKCCD 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 14/50 (28%)
DSL <479..518 CDD:302925 7/39 (18%)
DSL <567..606 CDD:302925 5/38 (13%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 10/41 (24%)
ChtBD2 89..136 CDD:214696 18/65 (28%)
CBM_14 278..332 CDD:279884 14/79 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.