DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and CG17145

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:378 Identity:77/378 - (20%)
Similarity:110/378 - (29%) Gaps:136/378 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 EPETGQCLCTAGWKNIKCDRPCDLNHFGQDCAK--VCD---CHNNAACNPQN----GSCTCAAGW 513
            :.:||:|:.:.......|...|      .|.||  |.|   |:....|..:.    |:|.....:
  Fly    69 DKDTGKCVKSLSTSTSSCSISC------ADRAKQFVADPKSCYGYYYCADEETALYGTCPQETHF 127

  Fly   514 --TGERCERK----CDTGKFGHDCAQKCQCDFNNSLACDATNGRCVCKQDWGGVHCETNCRSGYY 572
              |.:.|.|:    |.|..|.:....|...:|:|...|:..:   ||::   ||..:..|...||
  Fly   128 NATTQMCSRQHESDCTTSTFEYCSIVKNGVNFDNLQGCNMYH---VCEK---GVLKDKTCSKTYY 186

  Fly   573 GENCDKVCRCLNNSSCDPDSGNCICSAGWTGADC-AEPCPPGFYGMECKERCPEILHGNKSCDHI 636
                            ...:|.|:..|   ..|| |.|.|....|...|.      :.||   .:
  Fly   187 ----------------QASTGECVSKA---LVDCDAHPLPTDVCGKASKP------YENK---FV 223

  Fly   637 TGEILCRTGYIGLTCEHPCPAGLYGPGCKLKCNCEHGG--ECNHVTGQCQCLPGWTGSNCNESCP 699
            ..|..|| ||                   ..|..:..|  :.|         |.|      ..||
  Fly   224 ADEATCR-GY-------------------FYCAKQKDGTPDPN---------PVW------NQCP 253

  Fly   700 TDTYGQGCAQRCRCVHHKVCRKADGMCICETGWSGTRCDEVCPEGFYGEHCMNTCACPSANFQCH 764
            .|.:....:|.|                            :.|...|..|  :.|...:|:|...
  Fly   254 QDRFFDASSQMC----------------------------ITPSSVYCSH--DRCDGRTASFVVS 288

  Fly   765 AAHGC----VCRSGYTGDNCDELIASQRIADQSENSSRASVALTLVLMTLFAC 813
            |..||    .|..|.|   ..|........|..:.:...||      .|..||
  Fly   289 ATKGCRNYLSCSDGVT---VSERSCGNYFFDDQQGACTPSV------QTYTAC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925 11/49 (22%)
DSL <567..606 CDD:302925 6/38 (16%)
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 12/50 (24%)
CBM_14 278..327 CDD:279884 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.