DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and NimB3

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001033905.1 Gene:NimB3 / 3885611 FlyBaseID:FBgn0054003 Length:122 Species:Drosophila melanogaster


Alignment Length:102 Identity:33/102 - (32%)
Similarity:48/102 - (47%) Gaps:28/102 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ELYNVD-VVYTELQSFQERGSTWCVTFPPRCSTYRIKHRVVNKTKTI------AKNRIVRDCCDG 90
            :.::|| |.....::..||||..|         ||        |.|:      ::||....||||
  Fly    26 QFWSVDPVTQWRKEALAERGSGIC---------YR--------TLTVETINPNSRNRQFSYCCDG 73

  Fly    91 YIASAG----ECVPHCSEPCQHGRCISPEKCKCDHGY 123
            |:....    :|.|.|||.|.:|.|::||:|:|..||
  Fly    74 YVNKGTSQNLKCEPICSEDCSNGLCLAPEECECAPGY 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 18/65 (28%)
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
NimB3NP_001033905.1 PLN03223 <49..>106 CDD:215637 23/73 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.