DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Tie

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster


Alignment Length:288 Identity:55/288 - (19%)
Similarity:107/288 - (37%) Gaps:66/288 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   773 SGYTGDNCDELIASQRIADQSENSSRASVALTLVLMT-----LFACIIFAV--FIYYRR------ 824
            |....|....:||::|  |.:....|.:: :||||:.     |.|.|::.|  |:..||      
  Fly   701 SASPADISSTVIANER--DLNMEMRRMNL-VTLVLVAVGVIPLAAIILYLVRNFVIRRRAKQSEV 762

  Fly   825 ---------------------RVSNLKTEIAHVHYTHDTNPPSWP--PNHNFDNPVYGMQAETRL 866
                                 :|.:.:.|:.|.|:.|..:..:..  .||.....:...||..|.
  Fly   763 FDVCITDQQPISPVKKVDSKYQVDDDEDEVDHQHHQHMQHHQNHQNHQNHQHHQAMPMSQASQRD 827

  Fly   867 LPNNMRSKMNNFDQRSTMSTDYGDDCNASGRVGSYSINYNH--------DLLTKNLNADRTNPIV 923
            ..:|   :..|.|.::::::::.|...::.|:.|.....|.        |.|:.:..|.|   ||
  Fly   828 ANHN---RYGNNDDKTSLASEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSGHFGATR---IV 886

  Fly   924 YNESLKEEHVYDEIKHKEGYKDPVKIYSKILFPEDEYDHLDYSRPSTSQKPHY----HRMNDAML 984
            ..::::      ....:...||...|..|:...::....|.   .....:||.    :.|...:|
  Fly   887 AVKTIR------ACSAQVSLKDEANIMRKLGSHQNVVTLLG---ACVESEPHMLIMEYAMRGRLL 942

  Fly   985 NINQDEEKPSNVKNMTVLLNKPLPPTEP 1012
            ::.:.....:|:...:|...:.|.|..|
  Fly   943 SLLRAARSATNILPASVPGGRSLAPLSP 970

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
TieNP_523928.1 TyrKc 854..1183 CDD:197581 23/129 (18%)
PTKc 860..1187 CDD:270623 21/123 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.