powered by:
Protein Alignment drpr and AT2G34123
DIOPT Version :9
Sequence 1: | NP_001261276.1 |
Gene: | drpr / 38218 |
FlyBaseID: | FBgn0027594 |
Length: | 1042 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001031473.1 |
Gene: | AT2G34123 / 3768647 |
AraportID: | AT2G34123 |
Length: | 81 |
Species: | Arabidopsis thaliana |
Alignment Length: | 51 |
Identity: | 17/51 - (33%) |
Similarity: | 24/51 - (47%) |
Gaps: | 6/51 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 124 GGPACDINCPPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCADI 174
|.|.|...|.||:|.| .:|.::.:.|.:. |..|..|.|.|:|..|
plant 23 GPPKCIALCRPGYYER-----FECFHDCITEGYD-DGSCVPGPTTAKCGII 67
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D561378at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.