DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and Fgfrl1

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_954545.1 Gene:Fgfrl1 / 360903 RGDID:735156 Length:529 Species:Rattus norvegicus


Alignment Length:149 Identity:31/149 - (20%)
Similarity:43/149 - (28%) Gaps:41/149 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 CQ-----CAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPGWTGDVCANKCP 262
            ||     |||..|.|:...|.|.........:|.|....|.|: |.|:.|               
  Rat   395 CQTKKKPCAPASTLPVPGHRPPGTSRERSGDKDLPSLAVGICE-EHGSTM--------------- 443

  Fly   263 VGSYGPGCQESCECYKGAPCHHIT-GQCECPPGYRGERCFDECQLNTYGFNCSMTCDCANDAMCD 326
                             ||.|.:. |....|..|  .:.:.:...:|:...|:.|..|.......
  Rat   444 -----------------APQHILAPGSTAGPKLY--PKLYTDVHTHTHTHTCTHTLSCGGQGSSA 489

  Fly   327 RANGTCICNPGWTGAKCAE 345
            .|....:.|.....|.|.|
  Rat   490 PACPLSVLNTANLQALCPE 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877
EGF_CA 274..319 CDD:304395 9/45 (20%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
Fgfrl1NP_954545.1 I-set 29..112 CDD:400151
Ig strand A' 35..38 CDD:409353
Ig strand B 41..50 CDD:409353
Ig strand C 56..61 CDD:409353
Ig strand C' 64..67 CDD:409353
Ig strand D 72..77 CDD:409353
Ig strand E 78..84 CDD:409353
Ig strand F 91..99 CDD:409353
Ig strand G 102..112 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..152
IgI_2_FGFRL1-like 143..234 CDD:409442
Ig strand B 164..168 CDD:409442
Ig strand C 177..181 CDD:409442
Ig strand E 200..204 CDD:409442
Ig strand F 214..219 CDD:409442
Ig strand G 227..230 CDD:409442
Ig 242..350 CDD:416386
Ig strand A 242..245 CDD:409353
Ig strand A' 249..253 CDD:409353
Ig strand B 261..268 CDD:409353
Ig strand C 272..279 CDD:409353
Ig strand D 304..309 CDD:409353
Ig strand E 317..322 CDD:409353
Ig strand F 330..338 CDD:409353
Ig strand G 341..349 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.