DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and NimC4

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_609698.2 Gene:NimC4 / 34824 FlyBaseID:FBgn0260011 Length:377 Species:Drosophila melanogaster


Alignment Length:413 Identity:100/413 - (24%)
Similarity:138/413 - (33%) Gaps:136/413 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NICKRRELYNVDVVYTELQSFQERGSTWCVTFPPRCSTYRIKHRVVNKTKTIAK----------N 81
            |.|:|.|.....|..|:.:...::.|.|               ::..||:.|.:          :
  Fly    22 NYCERNETIRATVPVTKQRIIVKQPSKW---------------KIWKKTEKITEIYDSEEEQVTH 71

  Fly    82 RIVRDCCDGYI-ASAGECVPHCSEPC-QHGRCISPEKCKCDHGYGG------------PACDINC 132
            |:||:||.||: ..:|.|.|.||..| .|..|.:|::|:|..||..            |.|:..|
  Fly    72 RLVRECCPGYLQVESGLCEPICSRGCPAHASCAAPDRCECISGYVSARNHQDGSHYCEPICETPC 136

  Fly   133 PPGWYGRNCSMQCDCLNNAVCEPFSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENG---G 194
            |.|       .||...|.         |.|..|||..:..|   :|..| .|:..||..:|   |
  Fly   137 PAG-------AQCVTPNT---------CACRDGYTQLQPTD---DGVSG-GCAPVCRVGDGCANG 181

  Fly   195 KCHHVSGECQCAPGFTGPLCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPGWTGDVCAN 259
            ||..|. .|.|..|:.....:.||.: .......::.....|....|.|.:       |....|.
  Fly   182 KCIDVD-RCACNSGYRWDKAEERCIE-LSAESISEELETTEDNTDSPSTSS-------TAVFTAT 237

  Fly   260 KCP-------------------VGSYGPGCQESCECYKGAPCHHITGQCECPPGYRGERCFDECQ 305
            .||                   ||....||.....|..       :|.|:|..||..|    |..
  Fly   238 HCPDDFVLFRGECREKQFDSNDVGCLKSGCGPHQTCLD-------SGVCQCSDGYVPE----ESG 291

  Fly   306 LNTYGFNCSMT-CD---CANDAMCDRANGTCICNPGWT----GAKCA------------------ 344
            ..|...:|..| .|   ..|:|:.|...    .|| ||    |..|.                  
  Fly   292 EATGVLSCRRTLLDQILGLNEAIDDDDE----LNP-WTIPIIGVACGFLFVLLIVGLLGGRRYRQ 351

  Fly   345 ERICEANKYGLDC---NRTCECD 364
            ||...||| .::|   .:|.:.|
  Fly   352 ERAALANK-EMECQYSQKTVDVD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 17/74 (23%)
EGF_CA 274..319 CDD:304395 12/48 (25%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
NimC4NP_609698.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.