DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drpr and NimB5

DIOPT Version :9

Sequence 1:NP_001261276.1 Gene:drpr / 38218 FlyBaseID:FBgn0027594 Length:1042 Species:Drosophila melanogaster
Sequence 2:NP_001188802.1 Gene:NimB5 / 34815 FlyBaseID:FBgn0028936 Length:315 Species:Drosophila melanogaster


Alignment Length:329 Identity:89/329 - (27%)
Similarity:122/329 - (37%) Gaps:121/329 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KRRELYNVDVVYTELQSFQERGSTWCVTFPPRCSTYRIKHRVVNKTKTIAKNRIVRDCCDGYIAS 94
            ||||..   :...|.||  :||...|..:.|..:..:..:..|.:|....:..::..||.||.||
  Fly    78 KRREYL---IRSHETQS--DRGQHKCRIWVPPDTVEKYSYPSVIQTDQANRLSLIEVCCTGYSAS 137

  Fly    95 ----AGECVPHCSEPCQHGRCISPEKCKCDHGYGGPACDINCPPGWYGRNCSMQCDCLNNAVCEP 155
                ...|...|.  ||:|.|..|.:|:|   |.|           :.||               
  Fly   138 RLMGVTVCRAQCG--CQNGSCKIPGECEC---YDG-----------FVRN--------------- 171

  Fly   156 FSGDCECAKGYTGARCADICPEGFFGANCSEKCRCENGGKCHHVSGECQCAPG--------FTGP 212
            .:|||..|           ||.|           |:| |:| ::.|.|||.||        |..|
  Fly   172 DNGDCVFA-----------CPLG-----------CQN-GQC-YLDGSCQCDPGYKLDETRRFCRP 212

  Fly   213 LCDMRCPDGKHGAQCQQDCPCQNDGKCQPETGACMCNPGW--TGDVCANKCPVGSYGPGCQESCE 275
            :|...|     |:..:.:|       .:||  .|.|:.|:  |.|             |||..||
  Fly   213 ICSSGC-----GSSPRHNC-------TEPE--ICGCSKGYQLTDD-------------GCQPVCE 250

  Fly   276 --CYKGAPCHHITGQCECPPGYR---GERCFDECQLNTYGFNCSMTCDCANDAMCDRANGTCICN 335
              |..|..|.. ..||:|.|||.   |     .||.     :|...|   |:.:|...| .|:|:
  Fly   251 PDCGIGGLCKD-NNQCDCAPGYNLRDG-----VCQA-----DCYQKC---NNGVCVSRN-RCLCD 300

  Fly   336 PGWT 339
            ||:|
  Fly   301 PGYT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drprNP_001261276.1 EMI 27..92 CDD:284877 16/61 (26%)
EGF_CA 274..319 CDD:304395 16/49 (33%)
DSL <479..518 CDD:302925
DSL <567..606 CDD:302925
NimB5NP_001188802.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.